KEGG   Homo sapiens (human): 26525Help
Entry
26525             CDS       T01001                                 

Gene name
IL36RN, FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14
Definition
(RefSeq) interleukin 36 receptor antagonist
  KO
K05483  interleukin 36 receptor antagonist protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H01656  Psoriasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    26525 (IL36RN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    26525 (IL36RN)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   26525 (IL36RN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 26525
NCBI-ProteinID: NP_036407
OMIM: 605507
HGNC: 15561
Ensembl: ENSG00000136695
Vega: OTTHUMG00000131337
Pharos: Q9UBH0(Tbio)
UniProt: Q9UBH0 A0A024R518
Structure
PDB: 

Position
2q14.1
AA seq 155 aa AA seqDB search
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILG
VQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWF
LCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgagtggggcgctgtgcttccgaatgaaggactcggcattgaaggtgctttat
ctgcataataaccagcttctagctggagggctgcatgcagggaaggtcattaaaggtgaa
gagatcagcgtggtccccaatcggtggctggatgccagcctgtcccccgtcatcctgggt
gtccagggtggaagccagtgcctgtcatgtggggtggggcaggagccgactctaacacta
gagccagtgaacatcatggagctctatcttggtgccaaggaatccaagagcttcaccttc
taccggcgggacatggggctcacctccagcttcgagtcggctgcctacccgggctggttc
ctgtgcacggtgcctgaagccgatcagcctgtcagactcacccagcttcccgagaatggt
ggctggaatgcccccatcacagacttctacttccagcagtgtgactag

DBGET integrated database retrieval system