KEGG   Homo sapiens (human): 2653
Entry
2653              CDS       T01001                                 

Gene name
GCSH, GCE, NKH
Definition
(RefSeq) glycine cleavage system protein H
  KO
K02437  glycine cleavage system H protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Disease
H00191  Nonketotic hyperglycinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    2653 (GCSH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    2653 (GCSH)
SSDB
Motif
Pfam: GCV_H
Other DBs
NCBI-GeneID: 2653
NCBI-ProteinID: NP_004474
OMIM: 238330
HGNC: 4208
Ensembl: ENSG00000140905
Vega: OTTHUMG00000137626
Pharos: P23434(Tbio)
UniProt: P23434
Position
16q23.2
AA seq 173 aa
MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWV
TTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEV
TEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcgctgcgagtggtgcggagcgtgcgggccctgctctgcaccctgcgcgcggtcccg
tcacccgccgcgccctgcccgccgaggccctggcagctgggggtgggcgccgtccgtacg
ctgcgcactggacccgctctgctctcggtgcgtaaattcacagagaaacacgaatgggta
acaacagaaaatggcattggaacagtgggaatcagcaattttgcacaggaagcgttggga
gatgttgtttattgtagtctccctgaagttgggacaaaattgaacaaacaagatgagttt
ggtgctttggaaagtgtgaaagctgctagtgaactctattctcctttatcaggagaagta
actgaaattaatgaagctcttgcagaaaatccaggacttgtaaacaaatcttgttatgaa
gatggttggctgatcaagatgacactgagtaacccttcagaactagatgaacttatgagt
gaagaagcatatgagaaatacataaaatctattgaggagtga

DBGET integrated database retrieval system