KEGG   Homo sapiens (human): 26532Help
Entry
26532             CDS       T01001                                 

Gene name
OR10H3
Definition
(RefSeq) olfactory receptor family 10 subfamily H member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26532 (OR10H3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26532 (OR10H3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26532 (OR10H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26532
NCBI-ProteinID: NP_039226
HGNC: 8174
Ensembl: ENSG00000171936
Vega: OTTHUMG00000182390
Pharos: O60404(Tdark)
UniProt: O60404 A0A126GW93
Position
19p13.12
AA seq 316 aa AA seqDB search
MPGQNYRTISEFILSGFSAFPQQLLPVLFLLYLLMFLFTLLGNLLIMATVWIERRLHTPM
YLFLCALSISEILFTVAITPRMLADLLFTHRSITFVACAIQMFFSFMFGFTHSFLLMVMG
YDHYVTICHPLHYNMLMSPRGCAHLVAWTWAGGSVMGMMVTMMVFHLTFCGSNVIHHFLC
HVLSLLKLACGSKTSSVIMGVMLVCVTALIGCLFLIILSFVFIVAAILRIPSAEGRHKTF
STCVSHLTVVVMHYSFASLIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK
NAINKNFCRRFCPLSS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtcagaactacagaaccatatctgaatttatcctctctggcttctcagccttc
ccccagcagctcctgcctgtcttgttcctgctgtacctcctgatgttcctgttcacattg
cttggcaaccttcttatcatggccacagtttggattgaacgcagactccacacacccatg
tacctcttcttgtgtgccctctccatctctgagattctgttcactgttgccatcacccct
cgcatgctggctgatctgctcttcacccatcgttccatcacctttgtggcttgtgccatt
cagatgttcttctccttcatgtttggcttcactcactccttccttctcatggtcatgggc
tatgatcactacgtgaccatctgccacccactgcattacaacatgctaatgagtccccgt
ggctgtgcccatcttgtggcctggacctgggctggtggctcggtcatggggatgatggtg
acaatgatggtttttcacctcactttctgtgggtctaatgtgatccaccattttctctgt
catgtgctttccctcttgaagttggcctgtgggagcaagacatcatctgtcatcatgggt
gtgatgctggtgtgtgtcacagccctgataggctgtttgttcctcatcatcctctccttt
gtcttcattgtggctgccatcttgaggattccttctgctgagggccggcacaagactttc
tccacttgtgtatcccacctcactgtggtggtcatgcactatagttttgcctcccttatc
tacctcaaacccaagggcctccattctatgtacagtgatgccttgatggccaccacctat
actgtcttcacccccttcctcagcccaatcattttcagtctaaggaacaaggagctgaag
aatgccataaataaaaacttttgcagaaggttctgccctctaagctcctaa

DBGET integrated database retrieval system