KEGG   Homo sapiens (human): 26539
Entry
26539             CDS       T01001                                 

Gene name
OR10H1
Definition
(RefSeq) olfactory receptor family 10 subfamily H member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26539 (OR10H1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26539 (OR10H1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26539 (OR10H1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 26539
NCBI-ProteinID: NP_039228
HGNC: 8172
Ensembl: ENSG00000186723
Vega: OTTHUMG00000182285
Pharos: Q9Y4A9(Tdark)
UniProt: Q9Y4A9 A0A126GVU5
Position
19p13.12
AA seq 318 aa
MQRANHSTVTQFILVGFSVFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY
LFLCALSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFACH
VPPLLKLACGDDVLVVAKGVGLVCITALLGCFLLILLSYAFIVAAILKIPSAEGRNKAFS
TCASHLTVVVVHYGFASVIYLKPKSPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKV
AMKKTFFSKLYPEKNVMM
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcagagagccaatcactccacagtgacccaattcatcctcgtcggcttctctgtcttc
ccccacctccagctgatgctcttcctgctgttcctgctgatgtacctgttcacgctgctg
ggcaacctgctcatcatggccaccgtctggagcgagcgcagcctccacacgcccatgtac
ctcttcctgtgcgccctctccgtctccgagatcctctacaccgtggccatcatcccgcgc
atgctggccgacctgctgtccacccagcgctccatcgccttcctggcctgtgccagtcag
atgttcttctccttcagcttcggcttcacccactccttcctgctcaccgtcatgggctac
gaccgctacgtggccatctgccaccccctgcgctacaacgtgctcatgagcccgcggggc
tgcgcctgcctggtgggctgctcctgggctggtggcttggtcatggggatggtggtgacc
tcggccattttccacctcgccttctgtggacacaaggagatccaccattttgcttgccat
gtgccacctctgttgaagttggcctgtggagacgatgtgctggtggtggccaaaggcgtg
ggcttggtgtgtatcacggccctgctgggctgttttctcctcatcctcctctcctatgcc
ttcatcgtggccgccatcttgaagatcccttctgctgaaggtcggaacaaggccttctcc
acctgtgcctctcacctcactgtggtggtcgtgcactatggctttgcctccgtcatttac
ctgaagcccaaaagtccccagtctctggaaggagacaccttgatgggcatcacctacacg
gtcctcacacccttcctcagccccatcatcttcagcctcaggaacaaggagctgaaggtc
gccatgaagaagaccttcttcagtaaactctacccagaaaaaaatgtaatgatgtag

DBGET integrated database retrieval system