KEGG   Homo sapiens (human): 26574Help
Entry
26574             CDS       T01001                                 

Gene name
AATF, BFR2, CHE-1, CHE1, DED
Definition
(RefSeq) apoptosis antagonizing transcription factor
  KO
K14782  protein AATF/BFR2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    26574 (AATF)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    26574 (AATF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AATF-Che1 TRAUB Vif
Motif
Other DBs
NCBI-GeneID: 26574
NCBI-ProteinID: NP_036270
OMIM: 608463
HGNC: 19235
Ensembl: ENSG00000275700
Vega: OTTHUMG00000188458
Pharos: Q9NY61(Tbio)
UniProt: Q9NY61
Position
17q12
AA seq 560 aa AA seqDB search
MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLA
SASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDED
DLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGM
EEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEG
RIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQY
PDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFT
VYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVL
GKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLD
PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDAR
TELYRSLFGQLHPPDEGHGD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcggggccgcagcccctggcgctgcaactggaacagttgttgaacccgcgaccaagc
gaggcggaccctgaagcggaccccgaggaagccactgctgccagggtgattgacaggttt
gatgaaggggaagatggggaaggtgatttcctagtagtgggtagcattagaaaactggca
tcagcctccctcttggacacggacaaaaggtattgcggcaaaaccacctctagaaaagca
tggaatgaagaccattgggagcagactctgccaggatcgtctgatgaggaaatatctgat
gaggaagggtctggagatgaagattcagagggactgggtctggaggaatatgatgaggac
gacctgggtgctgctgaggaacaggagtgtggtgatcacagggagagcaagaagagcaga
agccactctgcaaaaacaccgggcttcagtgtccagagtatcagtgactttgagaaattt
accaagggaatggatgaccttgggagcagtgaggaggaggaagacgaagagagtggcatg
gaagaaggggatgacgcggaagactcccaaggcgagagtgaggaagacagggctggagat
agaaacagtgaggatgatggtgtggtgatgaccttctctagtgtcaaagtttctgaggaa
gtggagaaaggaagagccgtgaagaaccagatagcactgtgggaccagctcttggaagga
aggatcaaactacaaaaagctctgttgaccaccaaccagcttcctcaaccagatgttttc
ccattgttcaaggacaaaggtggcccagaattttccagtgccctgaaaaatagtcacaag
gcacttaaagcattgttgaggtcattggtaggtcttcaggaagagttgcttttccagtac
ccagacactagatatctagtagatgggacaaagcccaatgcgggaagtgaggagatttct
agtgaagatgatgagctggtagaagagaagaagcagcaacgaagaagggtccctgcaaag
aggaagctggagatggaggactatcccagcttcatggcaaagcgctttgccgactttaca
gtctacaggaaccgcacacttcagaaatggcacgataagaccaaactggcttctggaaaa
ctggggaagggttttggtgcctttgaacgctcaatcttgactcagatcgaccatattctg
atggacaaagagagattacttcgaaggacacagaccaagcgctctgtctatcgagttctt
ggcaaacctgagccagcagctcagcctgtcccagagagtttgccaggggaaccggagatc
cttcctcaagcccctgctaatgctcatctgaaggacttggatgaagaaatctttgatgat
gatgacttttaccaccagctccttcgagaactcatagaacggaagaccagctccttggat
cccaacgatcaggtggccatgggaaggcagtggcttgcaatccagaagttacgaagcaaa
atccacaaaaaagtagataggaaagccagcaaaggcaggaaacttcggtttcatgtcctt
agcaagctactgagtttcatggcacctattgaccatactacaatgaatgatgatgccagg
acagaactgtaccgctctctttttggccagctccaccctcccgacgaaggccacggggat
tga

DBGET integrated database retrieval system