KEGG   Homo sapiens (human): 26575Help
Entry
26575             CDS       T01001                                 

Gene name
RGS17, RGS-17, RGSZ2, hRGS17
Definition
(RefSeq) regulator of G protein signaling 17
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    26575 (RGS17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 26575
NCBI-ProteinID: NP_036551
OMIM: 607191
HGNC: 14088
Ensembl: ENSG00000091844
Vega: OTTHUMG00000015858
Pharos: Q9UGC6(Tbio)
UniProt: Q9UGC6
Structure
PDB: 

Position
6q25.2
AA seq 210 aa AA seqDB search
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaggcagcagtcccaaaatgaaggaacacctgccgtgtctcaagctcctgga
aaccagaggcccaacaacacctgttgcttttgttggtgctgttgttgcagctgctcctgc
ctcactgtgaggaatgaagaaagaggggaaaatgcgggaagacccacacacactacaaaa
atggagagtatccaggtcctagaggaatgccaaaaccccactgcagaggaagtcttgtcc
tggtctcaaaattttgacaagatgatgaaggccccagcaggaagaaaccttttcagagag
ttcctccgaacagaatacagtgaagagaacctacttttctggcttgcttgtgaagactta
aagaaggagcagaacaaaaaagtaattgaagaaaaggctaggatgatatatgaagattac
atttctatactatcaccaaaagaggtcagtcttgattctcgagttagagaggtgatcaat
agaaatctgttggatcccaatcctcacatgtatgaagatgcccaacttcagatatatact
ttaatgcacagagattcttttccaaggtttttgaactctcaaatttataagtcatttgtt
gaaagtactgctggctcttcttctgaatcttaa

DBGET integrated database retrieval system