KEGG   Homo sapiens (human): 26585
Entry
26585             CDS       T01001                                 

Gene name
GREM1, C15DUPq, CKTSF1B1, CRAC1, CRCS4, DAND2, DRM, DUP15q, GREMLIN, HMPS, HMPS1, IHG-2, MPSH, PIG2
Definition
(RefSeq) gremlin 1, DAN family BMP antagonist
  KO
K23318  gremlin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    26585 (GREM1)
SSDB
Motif
Pfam: DAN
Other DBs
NCBI-GeneID: 26585
NCBI-ProteinID: NP_037504
OMIM: 603054
HGNC: 2001
Ensembl: ENSG00000166923
Vega: OTTHUMG00000129319
Pharos: O60565(Tbio)
UniProt: O60565 A6XAA7
Structure
PDB: 
5AEJ

Position
15q13.3
AA seq 184 aa
MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS
IDLD
NT seq 555 nt   +upstreamnt  +downstreamnt
atgagccgcacagcctacacggtgggagccctgcttctcctcttggggaccctgctgccg
gctgctgaagggaaaaagaaagggtcccaaggtgccatccccccgccagacaaggcccag
cacaatgactcagagcagactcagtcgccccagcagcctggctccaggaaccgggggcgg
ggccaagggcggggcactgccatgcccggggaggaggtgctggagtccagccaagaggcc
ctgcatgtgacggagcgcaaatacctgaagcgagactggtgcaaaacccagccgcttaag
cagaccatccacgaggaaggctgcaacagtcgcaccatcatcaaccgcttctgttacggc
cagtgcaactctttctacatccccaggcacatccggaaggaggaaggttcctttcagtcc
tgctccttctgcaagcccaagaaattcactaccatgatggtcacactcaactgccctgaa
ctacagccacctaccaagaagaagagagtcacacgtgtgaagcagtgtcgttgcatatcc
atcgatttggattaa

DBGET integrated database retrieval system