KEGG   Homo sapiens (human): 26585Help
Entry
26585             CDS       T01001                                 

Gene name
GREM1, C15DUPq, CKTSF1B1, CRAC1, CRCS4, DAND2, DRM, DUP15q, GREMLIN, HMPS, HMPS1, IHG-2, MPSH, PIG2
Definition
(RefSeq) gremlin 1, DAN family BMP antagonist
  KO
K23318  gremlin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    26585 (GREM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN
Motif
Other DBs
NCBI-GeneID: 26585
NCBI-ProteinID: NP_037504
OMIM: 603054
HGNC: 2001
Ensembl: ENSG00000166923
Vega: OTTHUMG00000129319
Pharos: O60565(Tbio)
UniProt: O60565 A6XAA7
Structure
PDB: 

Position
15q13.3
AA seq 184 aa AA seqDB search
MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS
IDLD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacagcctacacggtgggagccctgcttctcctcttggggaccctgctgccg
gctgctgaagggaaaaagaaagggtcccaaggtgccatccccccgccagacaaggcccag
cacaatgactcagagcagactcagtcgccccagcagcctggctccaggaaccgggggcgg
ggccaagggcggggcactgccatgcccggggaggaggtgctggagtccagccaagaggcc
ctgcatgtgacggagcgcaaatacctgaagcgagactggtgcaaaacccagccgcttaag
cagaccatccacgaggaaggctgcaacagtcgcaccatcatcaaccgcttctgttacggc
cagtgcaactctttctacatccccaggcacatccggaaggaggaaggttcctttcagtcc
tgctccttctgcaagcccaagaaattcactaccatgatggtcacactcaactgccctgaa
ctacagccacctaccaagaagaagagagtcacacgtgtgaagcagtgtcgttgcatatcc
atcgatttggattaa

KEGG   Homo sapiens (human): 64388Help
Entry
64388             CDS       T01001                                 

Gene name
GREM2, CKTSF1B2, DAND3, PRDC, STHAG9
Definition
(RefSeq) gremlin 2, DAN family BMP antagonist
  KO
K23318  gremlin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Disease
H00625  Tooth agenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    64388 (GREM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot TIR_2
Motif
Other DBs
NCBI-GeneID: 64388
NCBI-ProteinID: NP_071914
OMIM: 608832
HGNC: 17655
Ensembl: ENSG00000180875
Vega: OTTHUMG00000039909
Pharos: Q9H772(Tbio)
UniProt: Q9H772 A0A024R3Y1
Position
1q43
AA seq 168 aa AA seqDB search
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttctggaagctttccctgtccttgttcctggtggcggtgctggtgaaggtggcggaa
gcccggaagaaccggccggcgggcgccatcccctcgccttacaaggacggcagcagcaac
aactcggagagatggcagcaccagatcaaggaggtgctggcctccagccaggaggccctg
gtggtcaccgagcgcaagtacctcaagagtgactggtgcaagacgcagccgctgcggcag
acggtgagcgaggagggctgccggagccgcaccatcctcaaccgcttctgctacggccag
tgcaactccttctacatcccgcggcacgtgaagaaggaggaggagtccttccagtcctgc
gccttctgcaagccccagcgcgtcacctccgtcctcgtggagctcgagtgccccggcctg
gacccacccttccgactcaagaaaatccagaaggtgaagcagtgccggtgcatgtccgtg
aacctgagcgactcggacaagcagtga

DBGET integrated database retrieval system