KEGG   Homo sapiens (human): 26586Help
Entry
26586             CDS       T01001                                 

Gene name
CKAP2, LB1, TMAP, se20-10
Definition
(RefSeq) cytoskeleton associated protein 2
  KO
K16769  cytoskeleton-associated protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26586 (CKAP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    26586 (CKAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CKAP2_C
Motif
Other DBs
NCBI-GeneID: 26586
NCBI-ProteinID: NP_001091995
OMIM: 611569
HGNC: 1990
Ensembl: ENSG00000136108
Vega: OTTHUMG00000016967
Pharos: Q8WWK9(Tbio)
UniProt: Q8WWK9
Position
13q14.3
AA seq 683 aa AA seqDB search
MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLSSSRDQRVVT
SEDQVQEGTKVLKLKTKMADKENMKRPAESKNNTVVGKHCIPLKPSNELTNSTVVIDTHK
PKDSNQTPHLLLTEDDPQSQHMTLSQAFHLKNNSKKKQMTTEKQKQDANMPKKPVLGSYR
GQIVQSKINSFRKPLQVKDESSAATKKLSATIPKATKPQPVNTSSVTVKSNRSSNMTATT
KFVSTTSQNTQLVRPPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSV
KTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQP
KETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFT
EKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENI
IAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGV
DVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYL
QSVKKKVQFDGTNSAFKELKFLTPVRRSRRLQEKTSKLPDMLKDHYPCVSSLEQLTELGR
ETDAFVCRPNAALCRVYYEADTT
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccggccgtgccccaggacctgcagctgcccccgagtcagagggcgcagtcc
gcattcaaagagcaaagaagacaaaaactcaaggaacatctgttgagaagaaaaacgctt
tttgcatacaagcaggaaaatgagatgttatccagtagtagagatcagagagttgtgaca
tctgaggaccaagttcaagaagggactaaagtgctgaaacttaaaacaaaaatggctgat
aaagaaaacatgaagagacctgcagagagcaaaaataatacagtggtggggaaacattgt
attcctttaaaaccttcaaatgaactaaccaattcaactgtagtaattgacacacataaa
cctaaggatagtaatcaaactccgcatttgttactaactgaagatgatccccaaagtcaa
catatgacattaagccaggcatttcaccttaaaaacaatagtaaaaagaaacaaatgact
acagaaaaacaaaagcaagatgctaacatgcccaagaaacctgtgcttggatcttatcgt
ggccagattgttcagtctaagattaattcatttagaaaacctctacaagtcaaagatgag
agttctgcagcaacaaagaaactttcagccactatacctaaagccacaaaacctcagcct
gtaaacaccagcagtgtaacagtgaaaagtaatagatcctccaatatgactgccactact
aaatttgtgagcactacatctcagaacacacaacttgtgcgacctcctattagaagtcat
cacagtaatacccgggacactgtgaaacaaggcatcagtagaacttctgccaatgttaca
atccggaaagggcctcatgaaaaagaactattacaatcaaaaacagctttatctagtgtc
aaaaccagttcttctcaaggtataataagaaataagactctatcaagatccatagcatct
gaagttatagccaggcctgcttcattgtctaatgataaactgatggaaaagtcagagccc
gttgaccagcgaagacatactgcaggaaaagcaattgttgatagtagatcagctcagccc
aaagaaacctcggaagagagaaaagctcgtctgagtgagtggaaagctggcaaaggaaga
gtgctaaaaaggccccctaattcagtagttactcagcatgagcctgcaggacaaaatgaa
aaaccagttgggtctttttggactaccatggcagaagaagatgaacaaagattatttact
gaaaaagtaaacaacacattttctgaatgcctgaacttgattaatgagggatgtccaaaa
gaagatatactggtcacactgaatgacctgattaaaaatattccagatgccaaaaagctt
gttaagtattggatatgtcttgcacttattgaaccaatcacaagtcctattgaaaatatt
attgcaatctatgagaaagccattctggcaggggctcagcctattgaagagatgcgacac
acgattgtagatattctaacaatgaagagtcaagaaaaagctaatttaggagaaaatatg
gagaagtcttgtgcaagcaaggaagaagtcaaagaagtcagtattgaagatacaggtgtt
gatgtagatccagaaaaactggaaatggagagtaaacttcatagaaatttgctatttcaa
gattgtgaaaaagagcaagacaacaaaacaaaagatccaacccatgatgttaaaaccccc
aatacagaaacgaggacaagttgcttaattaaatataatgtgtctactacgccatacttg
caaagtgtgaaaaaaaaggtgcagtttgatggaacaaattccgcatttaaagagctgaag
tttttaacaccagtgagacgttctcgacgtcttcaagagaaaacttctaaattgccagat
atgttaaaagatcattatccttgtgtgtcttcattggaacagctaacggagttgggaaga
gaaactgatgcttttgtatgccgccctaatgcagcactgtgccgggtgtactatgaggct
gatacaacataa

DBGET integrated database retrieval system