KEGG   Homo sapiens (human): 2660Help
Entry
2660              CDS       T01001                                 

Gene name
MSTN, GDF8, MSLHP
Definition
(RefSeq) myostatin
  KO
K05497  growth differentiation factor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Drug target
Domagrozumab: D11047
Ramatercept: D10347
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2660 (MSTN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2660 (MSTN)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   2660 (MSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 2660
NCBI-ProteinID: NP_005250
OMIM: 601788
HGNC: 4223
Ensembl: ENSG00000138379
Vega: OTTHUMG00000132663
Pharos: O14793(Tbio)
UniProt: O14793 Q53S46
Structure
PDB: 

Position
2q32.2
AA seq 375 aa AA seqDB search
MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQI
LSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIIT
MPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPM
KDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVT
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIA
PKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQII
YGKIPAMVVDRCGCS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactgcaactctgtgtttatatttacctgtttatgctgattgttgctggtcca
gtggatctaaatgagaacagtgagcaaaaagaaaatgtggaaaaagaggggctgtgtaat
gcatgtacttggagacaaaacactaaatcttcaagaatagaagccattaagatacaaatc
ctcagtaaacttcgtctggaaacagctcctaacatcagcaaagatgttataagacaactt
ttacccaaagctcctccactccgggaactgattgatcagtatgatgtccagagggatgac
agcagcgatggctctttggaagatgacgattatcacgctacaacggaaacaatcattacc
atgcctacagagtctgattttctaatgcaagtggatggaaaacccaaatgttgcttcttt
aaatttagctctaaaatacaatacaataaagtagtaaaggcccaactatggatatatttg
agacccgtcgagactcctacaacagtgtttgtgcaaatcctgagactcatcaaacctatg
aaagacggtacaaggtatactggaatccgatctctgaaacttgacatgaacccaggcact
ggtatttggcagagcattgatgtgaagacagtgttgcaaaattggctcaaacaacctgaa
tccaacttaggcattgaaataaaagctttagatgagaatggtcatgatcttgctgtaacc
ttcccaggaccaggagaagatgggctgaatccgtttttagaggtcaaggtaacagacaca
ccaaaaagatccagaagggattttggtcttgactgtgatgagcactcaacagaatcacga
tgctgtcgttaccctctaactgtggattttgaagcttttggatgggattggattatcgct
cctaaaagatataaggccaattactgctctggagagtgtgaatttgtatttttacaaaaa
tatcctcatactcatctggtacaccaagcaaaccccagaggttcagcaggcccttgctgt
actcccacaaagatgtctccaattaatatgctatattttaatggcaaagaacaaataata
tatgggaaaattccagcgatggtagtagaccgctgtgggtgctcatga

DBGET integrated database retrieval system