KEGG   Homo sapiens (human): 2661Help
Entry
2661              CDS       T01001                                 

Gene name
GDF9, POF14
Definition
(RefSeq) growth differentiation factor 9
  KO
K22673  growth differentiation factor 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2661 (GDF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2661 (GDF9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   2661 (GDF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta CAMSAP_CKK
Motif
Other DBs
NCBI-GeneID: 2661
NCBI-ProteinID: NP_005251
OMIM: 601918
HGNC: 4224
Ensembl: ENSG00000164404
Vega: OTTHUMG00000059842
Pharos: O60383(Tbio)
UniProt: O60383
Position
5q31.1
AA seq 454 aa AA seqDB search
MARPNKFLLWFCCFAWLCFPISLGSQASGGEAQIAASAELESGAMPWSLLQHIDERDRAG
LLPALFKVLSVGRGGSPRLQPDSRALHYMKKLYKTYATKEGIPKSNRSHLYNTVRLFTPC
TRHKQAPGDQVTGILPSVELLFNLDRITTVEHLLKSVLLYNINNSVSFSSAVKCVCNLMI
KEPKSSSRTLGRAPYSFTFNSQFEFGKKHKWIQIDVTSLLQPLVASNKRSIHMSINFTCM
KDQLEHPSAQNGLFNMTLVSPSLILYLNDTSAQAYHSWYSLHYKRRPSQGPDQERSLSAY
PVGEEAAEDGRSSHHRHRRGQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRL
SFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCV
PAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcccaacaaattcctcctttggttttgctgctttgcctggctgtgttttcct
attagccttggttctcaggcttctgggggagaagctcagattgctgctagtgctgagttg
gaatctggggctatgccttggtccttgctgcagcatatagatgagagagacagagctggc
ctccttcccgcgcttttcaaagttctatctgttgggcgaggtgggtcacctaggctgcag
ccagactccagagctttgcactacatgaagaagctctataagacatatgctaccaaggaa
gggattcctaaatccaatagaagtcacctctacaacactgttcggctcttcaccccctgt
acccggcacaagcaggctcctggagaccaggtaacaggaatccttccatcagtggaactg
ctatttaacctggatcgcattactaccgttgaacacttactcaagtcagtcttgctgtac
aatatcaacaactcagtttctttttcctctgctgtcaaatgtgtgtgcaatctaatgata
aaggagccaaagtcttctagcaggactctcggcagagctccatactcatttacctttaac
tcacagtttgaatttggaaagaaacacaaatggattcagattgatgtgaccagcctcctt
caacctttagtggcctccaacaagagaagtattcacatgtctataaattttacttgcatg
aaagaccagctggagcatccttcagcacagaatggtttgtttaacatgactctggtgtcc
ccctcactgatcttatatttgaatgacacaagtgctcaggcttatcacagctggtattcc
cttcactataaaaggaggccttcccagggtcctgaccaggagagaagtctgtctgcctat
cctgtgggagaagaggctgctgaggatgggagatcttcccatcaccgtcaccgcagaggt
caggaaactgtcagttctgaattgaagaagcccttgggcccagcttccttcaatctgagt
gaatacttcagacaatttcttcttccccaaaatgagtgtgagctccatgactttagactt
agctttagtcagctgaagtgggacaactggattgtggctccgcacaggtacaaccctcga
tactgtaaaggggactgtccaagggcagttggacatcggtatggctctccagttcacacc
atggtacagaacatcatctatgagaagctggactcctcagtgccaagaccgtcatgtgta
cctgccaaatacagccccttgagtgttttgaccattgagcccgatggctcaattgcctat
aaagagtacgaagatatgatagctacaaagtgcacctgtcgttaa

DBGET integrated database retrieval system