KEGG   Homo sapiens (human): 2665
Entry
2665              CDS       T01001                                 

Gene name
GDI2, HEL-S-46e, RABGDIB
Definition
(RefSeq) GDP dissociation inhibitor 2
  KO
K17255  Rab GDP dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2665 (GDI2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2665 (GDI2)
SSDB
Motif
Pfam: GDI
Other DBs
NCBI-GeneID: 2665
NCBI-ProteinID: NP_001485
OMIM: 600767
HGNC: 4227
Ensembl: ENSG00000057608
Vega: OTTHUMG00000017607
Pharos: P50395(Tbio)
UniProt: P50395 Q6IAT1
Position
10p15.1
AA seq 445 aa
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaatgaggagtacgacgtgatcgtgctgggcaccggcctgacggaatgtatcctgtca
ggtataatgtcagtgaatggcaagaaagttcttcatatggatcgaaacccttactacgga
ggagagagtgcatctataacaccattggaagatttatacaaaagatttaaaataccagga
tcaccacccgagtcaatggggagaggaagagactggaatgttgacttgattcccaagttc
cttatggctaatggtcagctggttaagatgctgctttatacagaggtaactcgctatctg
gattttaaagtgactgaagggagctttgtctataagggtggaaaaatctacaaggttcct
tccactgaagcagaagccctggcatctagcctaatgggattgtttgaaaaacgtcgcttc
aggaaattcctagtgtatgttgccaacttcgatgaaaaagatccaagaacttttgaaggc
attgatcctaagaagaccacaatgcgagatgtgtataagaaatttgatttgggtcaagac
gttatagattttactggtcatgctcttgcactttacagaactgatgattacttagatcaa
ccgtgttatgaaaccattaatagaattaaactttacagtgaatctttggcaagatatggc
aaaagcccatacctttatccactctatggccttggagaactgccccaaggatttgcaagg
ctaagtgctatttatggaggtacctatatgctgaataaacccattgaagaaatcattgta
cagaatggaaaagtaattggtgtaaaatctgaaggagaaattgctcgctgtaagcagctc
atctgtgaccccagctacgtaaaagatcgggtagaaaaagtgggccaggtgatcagagtt
atttgcatcctcagccaccccatcaagaacaccaatgatgccaactcctgccagatcatt
attccacagaaccaagtcaatcgaaagtcagatatctacgtctgcatgatctcctttgcg
cacaatgtagcagcacaagggaagtacattgctatagttagtacaactgtggaaaccaag
gagcctgagaaggaaatcagaccagctttggagctcttggaaccaattgaacagaaattt
gttagcatcagtgacctcctggtaccaaaagacttgggaacagaaagccagatctttatt
tcccgcacatatgatgccaccactcattttgagacaacgtgtgatgacattaaaaacatc
tataagaggatgacaggatcagagtttgactttgaggaaatgaagcgcaagaagaatgac
atctatggggaagactaa

DBGET integrated database retrieval system