KEGG   Homo sapiens (human): 266722Help
Entry
266722            CDS       T01001                                 

Gene name
HS6ST3, HS6ST-3
Definition
(RefSeq) heparan sulfate 6-O-sulfotransferase 3
  KO
K08103  heparan sulfate 6-O-sulfotransferase HS6ST3 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    266722 (HS6ST3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    266722 (HS6ST3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     266722 (HS6ST3)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   266722 (HS6ST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2 Phospholamban
Motif
Other DBs
NCBI-GeneID: 266722
NCBI-ProteinID: NP_703157
OMIM: 609401
HGNC: 19134
Ensembl: ENSG00000185352
Vega: OTTHUMG00000017232
Pharos: Q8IZP7(Tdark)
UniProt: Q8IZP7
Position
13q32.1
AA seq 471 aa AA seqDB search
MDERFNKWLLTPVLTLLFVVIMYQYVSPSCTSSCTNFGEQPRAGEAGPPAVPGPARRAQA
PPEEWERRPQLPPPPRGPPEGPRGAAAPEEEDEEPGDPREGEEEEEEDEPDPEAPENGSL
PRFVPRFNFSLKDLTRFVDFNIKGRDVIVFLHIQKTGGTTFGRHLVKNIRLEQPCSCKAG
QKKCTCHRPGKKETWLFSRFSTGWSCGLHADWTELTNCVPAIMEKKDCPRNHSHTRNFYY
ITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDELPTCYPGDDWSGVSLREFMD
CTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAFFGLTEFQRKT
QFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYAKDLFQQRYH
HTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaggttcaacaagtggctgctgacgccggtgctcactctcctcttcgtggtc
atcatgtaccagtacgtgtccccctcctgcaccagctcctgcaccaacttcggggagcag
ccccgcgcgggggaggccggcccgcccgccgtcccgggtcccgcccgccgggctcaggcg
ccgccggaggagtgggagcggcggccccagttgcccccgccgccccgggggccccccgag
ggacctcggggggccgcggcgccggaggaggaggacgaggagcccggagacccccgggag
ggggaggaagaggaggaggaagacgagccggaccccgaggccccggaaaacggctccctg
ccccgattcgtgccgcgcttcaacttcagcctgaaggacctgacccgcttcgtggatttc
aacatcaaagggcgcgacgtgatcgtgttcctccacatccagaagacggggggcaccact
ttcggccggcacctggtgaagaacatccggctggagcagccttgtagctgcaaagcgggt
cagaagaagtgcacctgccaccggcctggcaagaaggagacgtggctcttctcccgcttc
tccaccggctggagctgcgggctgcacgccgactggacggagctcaccaactgcgtgccg
gccatcatggagaagaaggactgtccccgcaaccacagccacaccaggaatttctattac
atcacaatgttacgggatccagtgtcacgttacctgagcgagtggaaacatgtccagaga
ggggccacttggaaaacctctcttcatatgtgtgatggaagaagccccaccccagatgag
ctgcctacctgctaccctggggatgactggtctggggtcagcttgcgggagtttatggat
tgcacctacaacctggctaacaatcgccaggtgcgcatgctggctgacctcagcctggtg
ggctgctataacttgactttcatgaacgagagtgaaagaaacaccatcctgttgcagagt
gcaaagaacaacctgaagaacatggccttctttgggctcactgagttccagaggaagaca
cagtttctctttgagagaacattcaacctcaagttcatctcccccttcacacagttcaac
atcacgcgggcttctaacgtggagatcaacgagggtgcccgccaacgcattgaggatcta
aacttcctggacatgcagctttacgagtatgcaaaagatctcttccagcagcgctaccac
cacaccaagcagctagagcaccagagggaccgccagaagcggcgggaggagcggaggctg
cagcgagagcacagggaccaccagtggcccaaagaagatggggctgcagaagggactgtc
accgaggactacaacagccaggtggtgagatggtga

DBGET integrated database retrieval system