KEGG   Homo sapiens (human): 2668Help
Entry
2668              CDS       T01001                                 

Gene name
GDNF, ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
Definition
(RefSeq) glial cell derived neurotrophic factor
  KO
K05452  glial cell derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Disease
H00910  Hirschsprung disease
H00916  Congenital central hypoventilation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2668 (GDNF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2668 (GDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 2668
NCBI-ProteinID: NP_000505
OMIM: 600837
HGNC: 4232
Ensembl: ENSG00000168621
Vega: OTTHUMG00000090809
Pharos: P39905(Tbio)
UniProt: P39905 A0A0S2Z3V2
Structure
PDB: 

Position
5p13.2
AA seq 211 aa AA seqDB search
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR
PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatgggatgtcgtggctgtctgcctggtgctgctccacaccgcgtccgccttc
ccgctgcccgccggtaagaggcctcccgaggcgcccgccgaagaccgctccctcggccgc
cgccgcgcgcccttcgcgctgagcagtgactcaaatatgccagaggattatcctgatcag
ttcgatgatgtcatggattttattcaagccaccattaaaagactgaaaaggtcaccagat
aaacaaatggcagtgcttcctagaagagagcggaatcggcaggctgcagctgccaaccca
gagaattccagaggaaaaggtcggagaggccagaggggcaaaaaccggggttgtgtctta
actgcaatacatttaaatgtcactgacttgggtctgggctatgaaaccaaggaggaactg
atttttaggtactgcagcggctcttgcgatgcagctgagacaacgtacgacaaaatattg
aaaaacttatccagaaatagaaggctggtgagtgacaaagtagggcaggcatgttgcaga
cccatcgcctttgatgatgacctgtcgtttttagatgataacctggtttaccatattcta
agaaagcattccgctaaaaggtgtggatgtatctga

DBGET integrated database retrieval system