KEGG   Homo sapiens (human): 26682
Entry
26682             CDS       T01001                                 

Gene name
OR4F4, OLA-7501, OR4F18
Definition
(RefSeq) olfactory receptor family 4 subfamily F member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26682 (OR4F4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26682 (OR4F4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26682 (OR4F4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 26682
NCBI-ProteinID: NP_001004195
HGNC: 8301
Ensembl: ENSG00000177693
Vega: OTTHUMG00000172272
Pharos: Q96R69(Tdark)
UniProt: Q96R69
Position
15q26.3
AA seq 305 aa
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH
SSVKF
NT seq 918 nt   +upstreamnt  +downstreamnt
atggtgactgaattcatttttctgggtctctctgattctcaggaactccagaccttccta
tttatgttgttttttgtattctatggaggaatcgtgtttggaaaccttcttattgtcata
acagtggtatctgactcccaccttcactctcccatgtacttcctgctagccaacctctca
ctcattgatctgtctctgtcttcagtcacagcccccaagatgattactgactttttcagc
cagcgcaaagtcatctctttcaagggctgccttgttcagatatttctccttcacttcttt
ggtgggagtgagatggtgatcctcatagccatgggctttgacagatatatagcaatatgc
aaacccctacactacactacaattatgtgtggcaacgcatgtgtcggcattatggctgtc
gcatggggaattggctttctccattcggtgagccagttggcctttgccgtgcacttaccc
ttctgtggtcccaatgaggtcgatagtttttattgtgaccttcctagggtaatcaaactt
gcctgtacagatacctacaggctagatattatggtcattgctaacagtggtgtgctcact
gtgtgttcttttgttcttctaatcatctcatacactatcatcctaatgaccatccagcat
tgccctttagataagtcgtccaaagctctgtccactttgactgctcacattacagtagtt
cttttgttctttggaccatgtgtctttatttatgcctggccattccccatcaagtcatta
gataaattccttgctgtattttattctgtgatcacccctctcttgaacccaattatatac
acactgaggaacaaagacatgaagacggcaataagacggctgagaaaatgggatgcacat
tctagtgtaaagttttag

DBGET integrated database retrieval system