KEGG   Homo sapiens (human): 26696Help
Entry
26696             CDS       T01001                                 

Gene name
OR2T1, OR1-25
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26696 (OR2T1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26696 (OR2T1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26696 (OR2T1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 26696
NCBI-ProteinID: NP_112166
HGNC: 8277
Ensembl: ENSG00000175143
Vega: OTTHUMG00000040450
Pharos: O43869(Tdark)
UniProt: O43869 A0A126GVY3
Position
1q44
AA seq 369 aa AA seqDB search
MWQEYYFLNVFFPLLKVCCLTINSHVVILLPWECYHLIWKILPYIGTTVGSMEEYNTSST
DFTFMGLFNRKETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYFLLSHLSLID
MMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPL
RYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEAPAVLKLACA
DTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKAFATCSSHMTVVSL
FYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKG
PQRVSGGVF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagaatactattttttaaatgttttcttcccacttttaaaagtttgctgccta
acaattaattcacatgttgttattttactgccctgggaatgctatcatcttatttggaag
atattaccttatatcggcacaactgtaggatcaatggaagagtacaacacatcctctaca
gacttcactttcatggggctgttcaacagaaaggaaacctcaggtcttatttttgccatc
atctctatcatcttcttcaccgcactgatggccaatggggttatgatcttcctgatccaa
acagatttgcgccttcatacacccatgtacttcctcctcagccacctttccttaattgac
atgatgtatatttccactattgtgcctaagatgctggttaattacctgctggatcaaagg
accatttcctttgtggggtgcacagctcaacacttcctctaccttacccttgtgggagct
gaattcttcctgctgggcctcatggcctatgaccgctatgtggccatttgcaaccctctg
agataccctgtcctcatgagccgccgggtctgttggatgattatagcaggttcctggttt
gggggctctttggatggcttcctcctaacccccatcaccatgagctttcccttctgcaat
tcccgggagattaaccacttcttctgtgaggcaccagcagtcctgaagttggcatgtgca
gacacagccctctacgagacagtgatgtatgtgtgctgtgttttgatgctgctgattcct
ttctctgtagtccttgcttcctatgcccgaatcctgactacagttcagtgcatgagctca
gtggagggcaggaagaaggcatttgccacttgctcatcccacatgactgtggtgtccttg
ttctacggggctgccatgtacacctacatgctgccacattcttaccacaagccagcccag
gacaaagtcctctctgtgttttacaccattctcacacccatgctgaaccccctcatctac
agccttagaaacaaggatgtgactggagctctgaagagggccttggggaggttcaagggt
cctcaaagggtgtcaggaggtgtcttttga

DBGET integrated database retrieval system