KEGG   Homo sapiens (human): 267
Entry
267               CDS       T01001                                 

Symbol
AMFR, GP78, RNF45
Name
(RefSeq) autocrine motility factor receptor
  KO
K10636  E3 ubiquitin-protein ligase AMFR [EC:2.3.2.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    267 (AMFR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    267 (AMFR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.36  RING-type E3 ubiquitin transferase (cysteine targeting)
     267 (AMFR)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    267 (AMFR)
  Multi subunit Ring-finger type E3
   ERAD complex
    267 (AMFR)
   LMBR1L-GP78-UBAC2 complex
    267 (AMFR)
SSDB
Motif
Pfam: G2BR zf-RING_2 zf-C3HC4_2 CUE zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_11 zf-rbx1 zf-RING_5 zf-ANAPC11 Zn_ribbon_17 Prok-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 267
NCBI-ProteinID: NP_001135
OMIM: 603243
HGNC: 463
Ensembl: ENSG00000159461
Vega: OTTHUMG00000133239
Pharos: Q9UKV5(Tbio)
UniProt: Q9UKV5
Structure
PDB: 

Position
16q13
AA seq 643 aa
MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAP
ARPSAGGPRARDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKD
KFWNFIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPM
SSHGRVLSLLVAMLLSCCGLAAVCSITGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIH
LWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRY
LFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLF
HNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDL
QLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLD
LSPRLEETLDFGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
SSEDDAASESFLPSEGASSDPVTLRRRMLAAAAERRLQKQQTS
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgccgctgctcttcctcgagcgcttcccctggcccagcctccgcacctacacgggcctc
agcggcctggccctgctgggcaccatcatcagcgcctaccgcgcgctcagccagcccgag
gccggccccggcgagccggaccagctaacggcctcgctgcagcctgagccgccggcgccc
gcccggccgagcgccgggggaccccgggcccgcgatgtggcccagtacctgctctcagac
agcctcttcgtgtgggttctagtaaataccgcttgctgtgttttgatgttggtggctaag
ctcatccagtgtattgtgtttggccctcttcgagtgagtgagagacagcatctcaaagac
aaattttggaattttattttctacaagttcattttcatctttggtgtgctgaatgtccag
acagtggaagaggtggtcatgtggtgcctctggtttgccggacttgtctttctgcacctg
atggttcagctctgcaaggatcgatttgaatatctttccttctcgcccaccacgccgatg
agcagccacggtcgagtcctgtccctgttggttgccatgctgctttcctgctgtggactg
gcggccgtctgctccatcaccggctacacccacggaatgcacaccttggctttcatggct
gcagagtctcttcttgtgacagtgaggactgctcatgtgattttacgatacgtaattcac
ctctgggacctcaaccacgaagggacgtgggaaggaaaggggacgtatgtctattacaca
gactttgtcatggagctcactctcctgtccctggacctcatgcaccatattcacatgttg
ttatttggcaacatctggttatccatggccagcctggtcatctttatgcagctgcgttac
ctgtttcatgaggtgcaacgtcgaattcgtcggcacaagaactatctacgtgtggttgga
aacatggaggccaggtttgcagttgcaactccagaggagctggctgtcaacaatgacgac
tgtgccatctgttgggactccatgcaggctgcgcggaaactgccctgtggacatcttttc
cacaactcctgtcttcgttcctggctagaacaagacacctcctgtccaacatgcagaatg
tctcttaatattgccgacaataatcgtgtcagggaagaacatcaaggagagaacttggat
gagaatttggttcctgtagcagcagccgaagggagacctcgcttaaaccaacacaatcac
ttcttccatttcgatgggtctcggattgcgagctggctgccgagtttttcggttgaagtg
atgcacaccaccaacattcttggcattacgcaggccagcaactcccagctcaatgcaatg
gctcatcagattcaagagatgtttccccaggttccataccatctggtactgcaggacctc
cagctgacacgctcagttgaaataacaacagacaatattttagaaggacggattcaagta
ccttttcctacacagcggtcagatagcatcagacctgcattgaacagtcctgtggaaagg
ccaagcagtgaccaggaagagggagaaacttctgctcagaccgagcgtgtgccactggac
ctcagtcctcgcctggaggagacgctggacttcggcgaggtggaagtggagcccagtgag
gtggaagacttcgaggctcgtgggagccgcttctccaagtctgctgatgagagacagcgc
atgctggtgcagcgtaaggacgaactcctccagcaagctcgcaaacgtttcttgaacaaa
agttctgaagatgatgcggcctcagagagcttcctcccctcggaaggtgcgtcctctgac
cccgtgaccctgcgtcgaaggatgctggctgccgccgcggaacggaggcttcagaagcag
cagacctcctag

DBGET integrated database retrieval system