KEGG   Homo sapiens (human): 2670Help
Entry
2670              CDS       T01001                                 

Gene name
GFAP, ALXDRD
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
Disease
H00065  Alexander disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    2670 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2670 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2670 (GFAP)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    2670 (GFAP)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     2670 (GFAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head Spc7 DUF1664 T6PP_N Jnk-SapK_ap_N GAS
Motif
Other DBs
NCBI-GeneID: 2670
NCBI-ProteinID: NP_002046
OMIM: 137780
HGNC: 4235
Ensembl: ENSG00000131095
Vega: OTTHUMG00000179866
Pharos: P14136(Tbio)
UniProt: P14136 K7EMP8
Structure
PDB: 

Position
17q21.31
AA seq 432 aa AA seqDB search
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagacgcatcacctccgctgctcgccgctcctacgtctcctcaggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggatttctccctggctggggcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggcagacgtctaccaggctgagctg
cgagagctgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggttgag
agggacaatctggcacaggacctggccactgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaagccgagaacaacctggctgcctatagacaggaagcagatgaagccacc
ctggcccgtctggatctggagaggaagattgagtcgctggaggaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagcttgacgtggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaagccgaagagtggtaccgctccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaagccaacgactaccggcgccagttgcagtccttgacctgcgacctggagtctctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcggcacgtgcgggag
gcggccagttatcaggaggcgctggcgcggctggaggaagaggggcagagcctcaaggac
gagatggcccgccacttgcaggagtaccaggacctgctcaatgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctagagggcgaggagaaccggatcaccattccc
gtgcagaccttctccaacctgcagattcgagaaaccagcctggacaccaagtctgtgtca
gaaggccacctcaagaggaacatcgtggtgaagaccgtggagatgcgggatggagaggtc
attaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system