KEGG   Homo sapiens (human): 26716
Entry
26716             CDS       T01001                                 
Symbol
OR2H1, 6M1-16, HS6M1-16, OLFR42A-9004-14, OLFR42A-9004.14/9026.2, OR2H6, OR2H8, OR6-2, dJ994E9.4
Name
(RefSeq) olfactory receptor family 2 subfamily H member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26716 (OR2H1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26716 (OR2H1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26716 (OR2H1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 26716
NCBI-ProteinID: NP_001304943
HGNC: 8252
Ensembl: ENSG00000204688
Pharos: Q9GZK4(Tdark)
UniProt: Q9GZK4 A0A024RCM6
Position
6:29457155..29464328
AA seq 316 aa
MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFF
LSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVP
SLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLRINSATAWRKAFGTCS
SHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR
RLLGKERDSRESWRAA
NT seq 951 nt   +upstreamnt  +downstreamnt
atggttaaccaaagctcccccatgggcttcctccttctgggcttctctgaacacccagca
ctggaaaggactctctttgtggttgtcttcacttcctacctcttgaccctggtgggcaac
acactcatcatcctgctgtctgtactgtaccccaggctccactctccaatgtactttttc
ctctctgacctctccttcttggacctctgctttaccacaagttgtgtcccccagatgctg
gtcaacctctggggcccaaagaagaccatcagcttcctgggatgctctgtccagctcttc
atcttcctgtccctggggaccactgagtgcatcctcctgacagtgatggcctttgaccga
tacgtggctgtctgccagcccctccactatgccaccatcatccacccccgcctgtgctgg
cagctggcatctgtggcctgggttatgagtctggttcaatcgatagtccagacaccatcc
accctccacttgcccttctgtccccaccagcagatagatgactttttatgtgaggtccca
tctctgattcgactctcctgtggagatacctcctacaatgaaatccagttggctgtgtcc
agtgtcatcttcgtggttgtgcctctcagcctcatccttgcctcttatggagccactgcc
caggcagtgctgaggattaactctgccacagcatggagaaaggcctttgggacctgctcc
tcccatctcactgtggtcaccctcttctacagctcagtcattgctgtctacctccagccc
aaaaatccgtatgcccaagggaggggcaagttctttggtctcttctatgcagtgggcact
ccttcacttaaccctctcgtatacaccctgaggaacaaggagataaagcgagcactcagg
aggttactagggaaggaaagagactccagggaaagctggagagctgcttaa

DBGET integrated database retrieval system