KEGG   Homo sapiens (human): 2673Help
Entry
2673              CDS       T01001                                 

Gene name
GFPT1, CMS12, CMSTA1, GFA, GFAT, GFAT_1, GFAT1, GFAT1m, GFPT, GFPT1L, MSLG
Definition
(RefSeq) glutamine--fructose-6-phosphate transaminase 1
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
hsa04931  Insulin resistance
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    2673 (GFPT1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2673 (GFPT1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    2673 (GFPT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2673 (GFPT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     2673 (GFPT1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C44
   2673 (GFPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 GATase_2 SIS_2
Motif
Other DBs
NCBI-GeneID: 2673
NCBI-ProteinID: NP_001231639
OMIM: 138292
HGNC: 4241
Ensembl: ENSG00000198380
Vega: OTTHUMG00000152666
Pharos: Q06210(Tchem)
UniProt: Q06210
Structure
PDB: 

Position
2p13.3
AA seq 699 aa AA seqDB search
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRW
GSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVA
AVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRG
RVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELAS
DFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGV
HINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLS
MDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLAL
VDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVD
CLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcttacttaaactaccatgttcctcgaacgagacgagaaatcctg
gagaccctaatcaaaggccttcagagactggagtacagaggatatgattctgctggtgtg
ggatttgatggaggcaatgataaagattgggaagccaatgcctgcaaaatccagcttatt
aagaagaaaggaaaagttaaggcactggatgaagaagttcacaagcaacaagatatggat
ttggatatagaatttgatgtacaccttggaatagctcatacccgttgggcaacacatgga
gaacccagtcctgtcaatagccacccccagcgctctgataaaaataatgaatttatcgtt
attcacaatggaatcatcaccaactacaaagacttgaaaaagtttttggaaagcaaaggc
tatgacttcgaatctgaaacagacacagagacaattgccaagctcgttaagtatatgtat
gacaatcgggaaagtcaagataccagctttactaccttggtggagagagttatccaacaa
ttggaaggtgcttttgcacttgtgtttaaaagtgttcattttcccgggcaagcagttggc
acaaggcgaggtagccctctgttgattggtgtacggagtgaacataaactttctactgat
cacattcctatactctacagaacagctaggactcagattggatcaaaattcacacggtgg
ggatcacagggagaaagaggcaaagacaagaaaggaagctgcaatctctctcgtgtggac
agcacaacctgccttttcccggtggaagaaaaagcagtggagtattactttgcttctgat
gcaagtgctgtcatagaacacaccaatcgcgtcatctttctggaagatgatgatgttgca
gcagtagtggatggacgtctttctatccatcgaattaaacgaactgcaggagatcacccc
ggacgagctgtgcaaacactccagatggaactccagcagatcatgaagggcaacttcagt
tcatttatgcagaaggaaatatttgagcagccagagtctgtcgtgaacacaatgagagga
agagtcaactttgatgactatactgtgaatttgggtggtttgaaggatcacataaaggag
atccagagatgccggcgtttgattcttattgcttgtggaacaagttaccatgctggtgta
gcaacacgtcaagttcttgaggagctgactgagttgcctgtgatggtggaactagcaagt
gacttcctggacagaaacacaccagtctttcgagatgatgtttgctttttccttagtcaa
tcaggtgagacagcagatactttgatgggtcttcgttactgtaaggagagaggagcttta
actgtggggatcacaaacacagttggcagttccatatcacgggagacagattgtggagtt
catattaatgctggtcctgagattggtgtggccagtacaaaggcttataccagccagttt
gtatcccttgtgatgtttgcccttatgatgtgtgatgatcggatctccatgcaagaaaga
cgcaaagagatcatgcttggattgaaacggctgcctgatttgattaaggaagtactgagc
atggatgacgaaattcagaaactagcaacagaactttatcatcagaagtcagttctgata
atgggacgaggctatcattatgctacttgtcttgaaggggcactgaaaatcaaagaaatt
acttatatgcactctgaaggcatccttgctggtgaattgaaacatggccctctggctttg
gtggataaattgatgcctgtgatcatgatcatcatgagagatcacacttatgccaagtgt
cagaatgctcttcagcaagtggttgctcggcaggggcggcctgtggtaatttgtgataag
gaggatactgagaccattaagaacacaaaaagaacgatcaaggtgccccactcagtggac
tgcttgcagggcattctcagcgtgatccctttacagttgctggctttccaccttgctgtg
ctgagaggctatgatgttgatttcccacggaatcttgccaaatctgtgactgtagagtga

KEGG   Homo sapiens (human): 9945Help
Entry
9945              CDS       T01001                                 

Gene name
GFPT2, GFAT, GFAT_2, GFAT2
Definition
(RefSeq) glutamine-fructose-6-phosphate transaminase 2
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    9945 (GFPT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    9945 (GFPT2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    9945 (GFPT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9945 (GFPT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     9945 (GFPT2)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C44
   9945 (GFPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 GATase_2 SIS_2 Acetyltransf_6
Motif
Other DBs
NCBI-GeneID: 9945
NCBI-ProteinID: NP_005101
OMIM: 603865
HGNC: 4242
Ensembl: ENSG00000131459
Vega: OTTHUMG00000163442
Pharos: O94808(Tbio)
UniProt: O94808 A0A0S2Z4X9 B3KMR8
Position
5q35.3
AA seq 682 aa AA seqDB search
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctttgcctacatgaactacagagtcccccggacgaggaaggagatcttc
gaaaccctcatcaagggcctgcagcggctggagtacagaggctacgactcggcaggtgtg
gcgatcgatgggaataatcacgaagtcaaagaaagacacattcagctggtcaagaaaagg
gggaaagtcaaggctctcgatgaagaactttacaaacaagacagcatggacttaaaagtg
gagtttgagacacacttcggcattgcccacacgcgctgggccacccacggggtccccagt
gctgtcaacagccaccctcagcgctcagacaaaggcaacgaatttgttgtcatccacaat
gggatcatcacaaattacaaagatctgaggaaatttctggaaagcaaaggctacgagttt
gagtcagaaacagatacagagaccatcgccaagctgattaaatatgtgttcgacaacaga
gaaactgaggacattacgttttcaacgttggtcgagagagtcattcagcagttggaaggt
gcattcgcgctggttttcaagagtgtccactacccaggagaagccgttgccacacggaga
ggcagccccctgctcatcggagtccggagcaaatacaagctctccacagaacagatccct
atcttatacaggacgtgcactctggagaatgtgaagaatatctgtaagacacggatgaag
aggctggacagctccgcctgcctgcatgctgtgggcgacaaggccgtggaattcttcttt
gcttctgatgcaagcgctatcatagagcacaccaaccgggtcatcttcctggaggacgat
gacatcgccgcagtggctgatgggaaactctccattcaccgggtcaagcgctcggccagt
gatgacccatctcgagccatccagaccttgcagatggaactgcagcaaatcatgaaaggt
aacttcagtgcgtttatgcagaaggagatcttcgaacagccagaatcagttttcaatact
atgagaggtcgggtgaattttgaaaccaacacagtgctcctgggtggcttgaaggaccac
ttgaaggagattcgacgatgccgacggctcatcgtgattggctgtggaaccagctaccac
gctgccgtggctacgcggcaagttttggaggaactgactgagcttcctgtgatggttgaa
cttgctagtgattttctggacaggaacacacctgtgttcagggatgacgtttgctttttc
atcagccagtcaggcgagaccgcggacaccctcctggcgctgcgctactgtaaggaccgc
ggcgctctcaccgtgggcgtcaccaacaccgtgggcagctccatctctcgcgagaccgac
tgcggcgtccacatcaacgcagggccggagatcggcgtggccagcaccaaggcttatacc
agtcagttcatctctctggtgatgtttggtttgatgatgtctgaagaccgaatttcacta
caaaacaggaggcaagagatcatccgtggcttgagatctttacctgagctgatcaaggaa
gtgctgtctctggaggagaagatccacgacttggccctggagctctacacgcagagatcg
ctgctggtgatggggcggggctacaactatgccacctgcctggaaggagccctgaaaatt
aaagagataacctacatgcactcagaaggcatcctggctggggagctgaagcacgggccc
ctggcactgattgacaagcagatgcccgtcatcatggtcattatgaaggatccttgcttc
gccaaatgccagaacgccctgcagcaagtcacggcccgccagggtcgccccattatactg
tgctccaaggacgatactgaaagttccaagtttgcgtataagacaattgagctgccccac
actgtggactgcctccagggcatcctgagcgtgattccgctgcagctgctgtccttccac
ctggctgttctccgaggatatgacgttgacttccccagaaatctggccaagtctgtaact
gtggaatga

DBGET integrated database retrieval system