KEGG   Homo sapiens (human): 2674Help
Entry
2674              CDS       T01001                                 

Gene name
GFRA1, GDNFR, GDNFRA, GFR-ALPHA-1, RET1L, RETL1, TRNR1
Definition
(RefSeq) GDNF family receptor alpha 1
  KO
K19895  GDNF family receptor alpha 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2674 (GFRA1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2674 (GFRA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDNF
Motif
Other DBs
NCBI-GeneID: 2674
NCBI-ProteinID: NP_001335027
OMIM: 601496
HGNC: 4243
Ensembl: ENSG00000151892
Vega: OTTHUMG00000019097
Pharos: P56159(Tbio)
UniProt: P56159
Position
10q25.3
AA seq 465 aa AA seqDB search
MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNF
SLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSP
YEPVNSRLSDIFRVVPFISDVFQQVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTT
SVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTERRRQTIVPVCSYEEREK
PNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMTPN
YIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV
QTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY
EKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttcctggcgaccctgtacttcgcgctgccgctcttggacttgctcctgtcggccgaa
gtgagcggcggagaccgcctggattgcgtgaaagccagtgatcagtgcctgaaggagcag
agctgcagcaccaagtaccgcacgctaaggcagtgcgtggcgggcaaggagaccaacttc
agcctggcatccggcctggaggccaaggatgagtgccgcagcgccatggaggccctgaag
cagaagtcgctctacaactgccgctgcaagcggggtatgaagaaggagaagaactgcctg
cgcatttactggagcatgtaccagagcctgcagggaaatgatctgctggaggattcccca
tatgaaccagttaacagcagattgtcagatatattccgggtggtcccattcatatcagat
gtttttcagcaagtggagcacattcccaaagggaacaactgcctggatgcagcgaaggcc
tgcaacctcgacgacatttgcaagaagtacaggtcggcgtacatcaccccgtgcaccacc
agcgtgtccaacgatgtctgcaaccgccgcaagtgccacaaggccctccggcagttcttt
gacaaggtcccggccaagcacagctacggaatgctcttctgctcctgccgggacatcgcc
tgcacagagcggaggcgacagaccatcgtgcctgtgtgctcctatgaagagagggagaag
cccaactgtttgaatttgcaggactcctgcaagacgaattacatctgcagatctcgcctt
gcggatttttttaccaactgccagccagagtcaaggtctgtcagcagctgtctaaaggaa
aactacgctgactgcctcctcgcctactcggggcttattggcacagtcatgacccccaac
tacatagactccagtagcctcagtgtggccccatggtgtgactgcagcaacagtgggaac
gacctagaagagtgcttgaaatttttgaatttcttcaaggacaatacatgtcttaaaaat
gcaattcaagcctttggcaatggctccgatgtgaccgtgtggcagccagccttcccagta
cagaccaccactgccactaccaccactgccctccgggttaagaacaagcccctggggcca
gcagggtctgagaatgaaattcccactcatgttttgccaccgtgtgcaaatttacaggca
cagaagctgaaatccaatgtgtcgggcaatacacacctctgtatttccaatggtaattat
gaaaaagaaggtctcggtgcttccagccacataaccacaaaatcaatggctgctcctcca
agctgtggtctgagcccactgctggtcctggtggtaaccgctctgtccaccctattatct
ttaacagaaacatcatag

DBGET integrated database retrieval system