KEGG   Homo sapiens (human): 26749
Entry
26749             CDS       T01001                                 

Gene name
GAGE2E, GAGE-2E, GAGE8
Definition
(RefSeq) G antigen 2E
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GAGE
Other DBs
NCBI-GeneID: 26749
NCBI-ProteinID: NP_001120672
OMIM: 300736
HGNC: 31960
UniProt: Q9UEU5
Position
Xp11.23
AA seq 116 aa
MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGED
EGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagttggcgaggaagatcgacctatcggcctagaccaagacgctacgtagagcctcct
gaaatgattgggcctatgcggcccgagcagttcagtgatgaagtggaaccagcaacacct
gaagaaggggaaccagcaactcaacgtcaggatcctgcagctgctcaggagggagaggat
gagggagcatctgcaggtcaagggccgaagcctgaagctgatagccaggaacagggtcac
ccacagactgggtgtgagtgtgaagatggtcctgatgggcaggagatggacccgccaaat
ccagaggaggtgaaaacgcctgaagaaggtgaaaagcaatcacagtgttaa

DBGET integrated database retrieval system