KEGG   Homo sapiens (human): 26762
Entry
26762             CDS       T01001                                 
Symbol
HAVCR1, CD365, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1
Name
(RefSeq) hepatitis A virus cellular receptor 1
  KO
K20413  hepatitis A virus cellular receptor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    26762 (HAVCR1)
CD molecules [BR:hsa04090]
 Proteins
  26762 (HAVCR1)
SSDB
Motif
Pfam: V-set ig Ig_2 I-set Ig_3
Other DBs
NCBI-GeneID: 26762
NCBI-ProteinID: NP_001166864
OMIM: 606518
HGNC: 17866
Ensembl: ENSG00000113249
Pharos: Q96D42(Tbio)
UniProt: Q96D42 B4DPB1
Structure
Position
5:complement(157029413..157069407)
AA seq 364 aa
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNG
IVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV
SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLT
TMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPT
TLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGV
CISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSL
YATD
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcatcctcaagtggtcatcttaagcctcatcctacatctggcagattctgtagctggt
tctgtaaaggttggtggagaggcaggtccatctgtcacactaccctgccactacagtgga
gctgtcacatccatgtgctggaatagaggctcatgttctctattcacatgccaaaatggc
attgtctggaccaatggaacccacgtcacctatcggaaggacacacgctataagctattg
ggggacctttcaagaagggatgtctctttgaccatagaaaatacagctgtgtctgacagt
ggcgtatattgttgccgtgttgagcaccgtgggtggttcaatgacatgaaaatcaccgta
tcattggagattgtgccacccaaggtcacgactactccaattgtcacaactgttccaacc
gtcacgactgttcgaacgagcaccactgttccaacgacaacgactgttccaatgacgact
gttccaacgacaactgttccaacaacaatgagcattccaacgacaacgactgttctgacg
acaatgactgtttcaacgacaacgagcgttccaacgacaacgagcattccaacaacaaca
agtgttccagtgacaacaactgtctctacctttgttcctccaatgcctttgcccaggcag
aaccatgaaccagtagccacttcaccatcttcacctcagccagcagaaacccaccctacg
acactgcagggagcaataaggagagaacccaccagctcaccattgtactcttacacaaca
gatgggaatgacaccgtgacagagtcttcagatggcctttggaataacaatcaaactcaa
ctgttcctagaacatagtctactgacggccaataccactaaaggaatctatgctggagtc
tgtatttctgtcttggtgcttcttgctcttttgggtgtcatcattgccaaaaagtatttc
ttcaaaaaggaggttcaacaactaagtgtttcatttagcagccttcaaattaaagctttg
caaaatgcagttgaaaaggaagtccaagcagaagacaatatctacattgagaatagtctt
tatgccacggactaa

DBGET integrated database retrieval system