KEGG   Homo sapiens (human): 2678Help
Entry
2678              CDS       T01001                                 

Gene name
GGT1, CD224, D22S672, D22S732, GGT, GGT_1, GGTD, GTG
Definition
(RefSeq) gamma-glutamyltransferase 1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Drug target
Acivicin: D02755
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2678 (GGT1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    2678 (GGT1)
   00480 Glutathione metabolism
    2678 (GGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    2678 (GGT1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2678 (GGT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     2678 (GGT1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     2678 (GGT1)
    3.4.19.14  leukotriene-C4 hydrolase
     2678 (GGT1)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   2678 (GGT1)
CD molecules [BR:hsa04090]
 Proteins
  2678 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept DUF4148
Motif
Other DBs
NCBI-GeneID: 2678
NCBI-ProteinID: NP_001275762
OMIM: 612346
HGNC: 4250
Ensembl: ENSG00000100031
Vega: OTTHUMG00000030859
Pharos: P19440(Tbio)
UniProt: P19440 A0A140VJJ9
Structure
PDB: 

Position
22q11.23
AA seq 569 aa AA seqDB search
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN
SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALEN
KRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKD
IQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSR
ESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD
DTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTA
TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTF
IAVVQAIVRTAGGWAAASDSRKGGEPAGY
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaagttagtggtgctgggcctgctggccgtggtcctggtgctggtcattgtc
ggcctctgtctctggctgccctcagcctccaaggaacctgacaaccatgtgtacaccagg
gctgccgtggccgcggatgccaagcagtgctcgaagattgggagggatgcactgcgggac
ggtggctctgcggtggatgcagccattgcagccctgttgtgtgtggggctcatgaatgcc
cacagcatgggcatcgggggtggcctcttcctcaccatctacaacagcaccacacgaaaa
gctgaggtcatcaacgcccgcgaggtggcccccaggctggcctttgccaccatgttcaac
agctcggagcagtcccagaagggggggctgtcggtggcggtgcctggggagatccgaggc
tatgagctggcacaccagcggcatgggcggctgccctgggctcgcctcttccagcccagc
atccagctggcccgccagggcttccccgtgggcaagggcttggcggcagccctggaaaac
aagcggaccgtcatcgagcagcagcctgtcttgtgtgaggtgttctgccgggatagaaag
gtgcttcgggagggggagagactgaccctgccgcagctggctgacacctacgagacgctg
gccatcgagggtgcccaggccttctacaacggcagcctcacggcccagattgtgaaggac
atccaggcggccgggggcattgtgacagctgaggacctgaacaactaccgtgctgagctg
atcgagcacccgctgaacatcagcctgggagacgtggtgctgtacatgcccagtgcgccg
ctcagcgggcccgtgctggccctcatcctcaacatcctcaaagggtacaacttctcccgg
gagagcgtggagagccccgagcagaagggcctgacgtaccaccgcatcgtagaggctttc
cggtttgcctacgccaagaggaccctgcttggggaccccaagtttgtggatgtgactgag
gtggtccgcaacatgacctccgagttcttcgctgcccagctccgggcccagatctctgac
gacaccactcacccgatctcctactacaagcccgagttctacacgccggatgacgggggc
actgctcacctgtctgtcgtcgcagaggacggcagtgctgtgtccgccaccagcaccatc
aacctctactttggctccaaggtccgctccccggtcagcgggatcctgttcaataatgaa
atggacgacttcagctctcccagcatcaccaacgagtttggggtacccccctcacctgcc
aatttcatccagccagggaagcagccgctctcgtccatgtgcccgacgatcatggtgggc
caggacggccaggtccggatggtggtgggagctgctgggggcacacagatcaccacggcc
actgcactggccatcatctacaacctctggttcggctatgacgtgaagcgggccgtggag
gagccccggctgcacaaccagcttctgcccaacgtcacgacagtggagagaaacattgac
caggcagtgactgcagccctggagacccggcaccatcacacccagatcgcgtccaccttc
atcgctgtggtgcaagccatcgtccgcacggctggtggctgggcagctgcctcggactcc
aggaaaggcggggagcctgccggctactga

DBGET integrated database retrieval system