KEGG   Homo sapiens (human): 2678
Entry
2678              CDS       T01001                                 

Symbol
GGT1, CD224, D22S672, D22S732, GGT, GGT_1, GGTD, GTG
Name
(RefSeq) gamma-glutamyltransferase 1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Drug target
Acivicin: D02755
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2678 (GGT1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    2678 (GGT1)
   00480 Glutathione metabolism
    2678 (GGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2678 (GGT1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2678 (GGT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     2678 (GGT1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     2678 (GGT1)
    3.4.19.14  leukotriene-C4 hydrolase
     2678 (GGT1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   2678 (GGT1)
CD molecules [BR:hsa04090]
 Proteins
  2678 (GGT1)
SSDB
Motif
Pfam: G_glu_transpept DUF4148
Other DBs
NCBI-GeneID: 2678
NCBI-ProteinID: NP_001275762
OMIM: 612346
HGNC: 4250
Ensembl: ENSG00000100031 ENSG00000286070
Vega: OTTHUMG00000030859
Pharos: P19440(Tbio)
UniProt: P19440 A0A140VJJ9
Structure
PDB: 

Position
22q11.23
AA seq 569 aa
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN
SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALEN
KRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKD
IQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSR
ESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD
DTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTA
TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTF
IAVVQAIVRTAGGWAAASDSRKGGEPAGY
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaagaagaagttagtggtgctgggcctgctggccgtggtcctggtgctggtcattgtc
ggcctctgtctctggctgccctcagcctccaaggaacctgacaaccatgtgtacaccagg
gctgccgtggccgcggatgccaagcagtgctcgaagattgggagggatgcactgcgggac
ggtggctctgcggtggatgcagccattgcagccctgttgtgtgtggggctcatgaatgcc
cacagcatgggcatcgggggtggcctcttcctcaccatctacaacagcaccacacgaaaa
gctgaggtcatcaacgcccgcgaggtggcccccaggctggcctttgccaccatgttcaac
agctcggagcagtcccagaagggggggctgtcggtggcggtgcctggggagatccgaggc
tatgagctggcacaccagcggcatgggcggctgccctgggctcgcctcttccagcccagc
atccagctggcccgccagggcttccccgtgggcaagggcttggcggcagccctggaaaac
aagcggaccgtcatcgagcagcagcctgtcttgtgtgaggtgttctgccgggatagaaag
gtgcttcgggagggggagagactgaccctgccgcagctggctgacacctacgagacgctg
gccatcgagggtgcccaggccttctacaacggcagcctcacggcccagattgtgaaggac
atccaggcggccgggggcattgtgacagctgaggacctgaacaactaccgtgctgagctg
atcgagcacccgctgaacatcagcctgggagacgtggtgctgtacatgcccagtgcgccg
ctcagcgggcccgtgctggccctcatcctcaacatcctcaaagggtacaacttctcccgg
gagagcgtggagagccccgagcagaagggcctgacgtaccaccgcatcgtagaggctttc
cggtttgcctacgccaagaggaccctgcttggggaccccaagtttgtggatgtgactgag
gtggtccgcaacatgacctccgagttcttcgctgcccagctccgggcccagatctctgac
gacaccactcacccgatctcctactacaagcccgagttctacacgccggatgacgggggc
actgctcacctgtctgtcgtcgcagaggacggcagtgctgtgtccgccaccagcaccatc
aacctctactttggctccaaggtccgctccccggtcagcgggatcctgttcaataatgaa
atggacgacttcagctctcccagcatcaccaacgagtttggggtacccccctcacctgcc
aatttcatccagccagggaagcagccgctctcgtccatgtgcccgacgatcatggtgggc
caggacggccaggtccggatggtggtgggagctgctgggggcacacagatcaccacggcc
actgcactggccatcatctacaacctctggttcggctatgacgtgaagcgggccgtggag
gagccccggctgcacaaccagcttctgcccaacgtcacgacagtggagagaaacattgac
caggcagtgactgcagccctggagacccggcaccatcacacccagatcgcgtccaccttc
atcgctgtggtgcaagccatcgtccgcacggctggtggctgggcagctgcctcggactcc
aggaaaggcggggagcctgccggctactga

KEGG   Homo sapiens (human): 2687
Entry
2687              CDS       T01001                                 

Symbol
GGT5, GGL, GGT_5, GGT-REL, GGTLA1
Name
(RefSeq) gamma-glutamyltransferase 5
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Drug target
Acivicin: D02755
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2687 (GGT5)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    2687 (GGT5)
   00480 Glutathione metabolism
    2687 (GGT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2687 (GGT5)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2687 (GGT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     2687 (GGT5)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     2687 (GGT5)
    3.4.19.14  leukotriene-C4 hydrolase
     2687 (GGT5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   2687 (GGT5)
CD molecules [BR:hsa04090]
 Proteins
  2687 (GGT5)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 2687
NCBI-ProteinID: NP_004112
OMIM: 137168
HGNC: 4260
Ensembl: ENSG00000099998
Vega: OTTHUMG00000150796
Pharos: P36269(Tbio)
UniProt: P36269
Position
22q11.23
AA seq 586 aa
MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAI
LQQQGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPS
LLDQCAQALPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVL
SRFLHNSILRPSLQASTLRQLFFNGTEPLRPQDPLPWPALATTLETVATEGVEVFYTGRL
GQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTLYSPPPPAGGAILSFILNVLR
GFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASRDLLGETLAQL
IRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKA
QGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEV
QRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcccggggctacggggccacggtcagcctagtcctgctgggtctggggctggcgctg
gctgtcattgtgctggctgtggtcctctctcgacaccaggccccatgtggcccccaggcc
tttgcccacgctgctgttgccgccgactccaaggtctgctcggatattggacgagccatc
ctccagcagcagggctcacccgtggatgccaccatcgcggctctggtctgcaccagcgtc
gtcaaccctcagagcatgggcctgggcggaggggtcatcttcaccatctacaatgtgaca
acagggaaggtggaggtcatcaatgcccgggagacggtgccggccagccacgccccgagc
ctgctggaccagtgtgcacaggctctgccactgggcacaggggcccagtggatcggggtg
cccggggagctccgtggctatgccgaggcccaccgccgccatggccgcctgccctgggcg
cagctgttccagcccaccatcgcgctgctccgaggggggcatgtggtggcccctgtcctc
agccgtttcctgcacaacagcatcctgcggccttccttgcaggcgtcaaccctgcgccag
ctcttcttcaacgggacagaacccctgaggcctcaggacccactcccatggcctgcactg
gccaccaccctggagaccgtggccacagagggcgtggaggtcttctacacggggaggctg
ggccagatgctggtggaggacattgccaaggaagggagccagctgacgctgcaggacctg
gccaagttccagcccgaggtggtggatgccctggaggtgcccctgggggactataccctg
tactcaccaccgccgcctgcagggggtgccattctcagctttatcctcaacgtgctaaga
gggttcaacttctcaacagagtctatggccaggcctgaagggagggtgaacgtgtaccac
caccttgtagagacgctcaagtttgccaaggggcagaggtggaggctgggggaccctcga
agccacccgaagctccagaatgcctcccgggacctgctgggggagaccctggcccagctc
atccgccaacagatcgatggccggggggaccaccagctcagccactacagcttggccgag
gcctggggccacgggacaggcacgtcccatgtgtctgtgctgggggaggatggcagcgcc
gtggctgccaccagcaccatcaacacaccctttggagcgatggtgtattcaccacggaca
ggcatcatcctcaacaacgagctcctggacttatgcgagcgatgcccccggggttccggc
accaccccctcacctgtgagtggagacagggtgggtggagctcccggaaggtgctggccc
ccagttccaggcgagcgttccccatcctccatggtgccctccatcttgatcaacaaagcc
caggggtcgaagctagtgattggcggggctggcggggagctcatcatctctgctgtggcc
caggccatcatgagcaagctgtggcttggctttgacctgagagcggccattgcagccccc
atcctgcatgtcaacagcaagggctgtgtggagtacgagcccaacttcagccaggaggtg
cagaggggactccaagaccgtggccagaaccagacccagaggcccttcttcctgaacgtg
gtccaggctgtgtcccaggagggggcctgtgtgtacgccgtctcggacctgaggaagagt
ggggaggccgcaggctactaa

DBGET integrated database retrieval system