KEGG   Homo sapiens (human): 2686Help
Entry
2686              CDS       T01001                                 

Gene name
GGT7, D20S101, GGT4, GGTL3, GGTL5
Definition
(RefSeq) gamma-glutamyltransferase 7
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Drug target
Acivicin: D02755
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    2686 (GGT7)
   00480 Glutathione metabolism
    2686 (GGT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2686 (GGT7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     2686 (GGT7)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     2686 (GGT7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   2686 (GGT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 2686
NCBI-ProteinID: NP_821158
OMIM: 612342
HGNC: 4259
Ensembl: ENSG00000131067
Vega: OTTHUMG00000032314
Pharos: Q9UJ14(Tbio)
UniProt: Q9UJ14 A0PJJ9
Position
20q11.22
AA seq 662 aa AA seqDB search
MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATG
VTVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPH
SSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLH
EAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETFLPSGRPPL
PGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVEK
PVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS
RLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMG
PDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPL
SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL
QSNLLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIAVKDPRSPDAAGAT
IL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagaacgaggccagccaggagagcgccctgggcgcctactcgccagtggac
tacatgagcatcaccagcttcccgcggctgcccgaggacgagccggcgcccgcggccccg
ctgaggggccgcaaggacgaggacgcctttctgggagaccccgacaccgacccggactcc
ttcctgaagtctgcacggctgcagcggctgccatcgtcgtcgtcggagatgggcagccaa
gacgggtcgccgctacgcgagacgcgcaaagacccgttctccgccgcagcggccgagtgc
tcctgccgccaggatgggctcacggtcatcgtcacggcctgtctcaccttcgctaccggt
gtcaccgtggcgctggtcatgcagatctacttcggggacccccagatcttccagcagggt
gccgtggtgaccgatgctgcccgctgcacttcactgggcatcgaggtgctcagtaaacag
ggatcttctgtggacgcagcggtggcagcagccttgtgtttgggtatcgtggctccacac
agttctggcctgggcggtgggggcgtgatgctggtacatgacatccgacgaaatgagagc
cacctaattgatttccgggagtccgcaccaggggccctcagggaagagaccctgcaaaga
tcctgggagaccaagcctgggctcttggtgggggttcccggaatggtgaaggggctacat
gaagctcaccagctctatggcaggctgccatggtcccaagtcctggcctttgcagcagct
gtggcccaagatggcttcaacgtgactcatgatctagcccgtgccctggctgaacagctg
ccacccaacatgtccgagcgcttccgggagacgttcctgccatcgggccgcccgccacta
cctggctcgttgctgcatcggcccgacctggctgaggtgctggatgtacttggcacctcc
ggcccggctgccttctacgcaggtggcaacctcacactggagatggtggccgaggctcag
cacgcagggggtgtcataaccgaagaggacttcagcaattacagcgcccttgtggagaag
cctgtgtgtggcgtgtacagaggccacctggttcttagtcccccacctccgcacacgggc
cctgccctcatcagtgctctcaacatcctggagggcttcaatctcaccagcctggtatcc
cgagaacaggctcttcactgggtggcagagaccctgaagattgcattagccctggccagc
agactgggagatcccgtctatgattctaccatcactgagagcatggatgacatgctcagc
aaggtggaggccgcctacctccggggccatatcaatgactcccaggcagcccctgcccca
ctcctgcctgtctatgaactagacggagctcccacggctgcccaggtgctgatcatggga
cctgatgacttcattgtggccatggttagctccctgaaccagccctttggcagcggcctt
atcaccccctcggggatcctgctcaacagccagatgctggacttctcctggcccaaccgg
acagctaaccactctgcacccagcctggagaattcagtgcagccagggaagcggccactc
tctttcctgctgcccacagtggtccgacccgcggaggggctctgtggaacctacctcgct
ctgggggccaatggagctgcgcggggcctcagcggcctgacacaggttctgctgaatgtc
ctgaccttgaaccggaacctgagtgacagcctggcccgcggccgcctacacccggacctg
cagtccaacctcctgcaggtggacagtgagttcacagaggaagagattgagttcctggaa
gccaggggtcaccacgtggagaaagtagatgtcttatcctgggtccatggcagccgaagg
accaacaacttcatcatcgctgttaaggaccctcggagcccagatgcagctggagccacc
atcctgtag

DBGET integrated database retrieval system