KEGG   Homo sapiens (human): 2688Help
Entry
2688              CDS       T01001                                 

Gene name
GH1, GH, GH-N, GHB5, GHN, IGHD1B, hGH-N
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
Disease
H00254  Growth hormone deficiency
H01700  Hypopituitarism
H02035  Isolated growth hormone deficiency
H02039  Kowarski syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2688 (GH1)
   04151 PI3K-Akt signaling pathway
    2688 (GH1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2688 (GH1)
   04060 Cytokine-cytokine receptor interaction
    2688 (GH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2688 (GH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1
Motif
Other DBs
NCBI-GeneID: 2688
NCBI-ProteinID: NP_000506
OMIM: 139250
HGNC: 4261
Ensembl: ENSG00000259384
Vega: OTTHUMG00000172293
Pharos: P01241(Tbio)
UniProt: P01241 B1A4G6
Structure
PDB: 

Position
17q23.3
AA seq 217 aa AA seqDB search
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggctcccggacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgtctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgtttc
tcagagtctattccgacaccctccaacagggaggaaacacaacagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtcttcgccaacagcctggtgtacggcgcctctgacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagttcgacacaaactcacacaacgatgac
gcactactcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system