KEGG   Homo sapiens (human): 2689Help
Entry
2689              CDS       T01001                                 

Gene name
GH2, GH-V, GHB2, GHL, GHV, hGH-V
Definition
(RefSeq) growth hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2689 (GH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1 DUF594
Motif
Other DBs
NCBI-GeneID: 2689
NCBI-ProteinID: NP_002050
OMIM: 139240
HGNC: 4262
Ensembl: ENSG00000136487
Vega: OTTHUMG00000172284
Pharos: P01242(Tbio)
UniProt: P01242 A0A0M6L0J9
Position
17q23.3
AA seq 217 aa AA seqDB search
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system