KEGG   Homo sapiens (human): 2690Help
Entry
2690              CDS       T01001                                 

Gene name
GHR, GHBP, GHIP
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
Disease
H00254  Growth hormone deficiency
H02037  Laron syndrome
Drug target
Atesidorsen: D11161
Atesidorsen sodium: D11162
Mecasermin: D03297
Mecasermin rinfabate: D04870
Pegvisomant: D05394
Somapacitan: D11194
Somatrem: D05884
Somatropin: D02691
Somavaratan: D11193
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    2690 (GHR)
   04151 PI3K-Akt signaling pathway
    2690 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2690 (GHR)
   04060 Cytokine-cytokine receptor interaction
    2690 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    2690 (GHR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   2690 (GHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHBP EpoR_lig-bind fn3
Motif
Other DBs
NCBI-GeneID: 2690
NCBI-ProteinID: NP_000154
OMIM: 600946
HGNC: 4263
Ensembl: ENSG00000112964
Vega: OTTHUMG00000094791
Pharos: P10912(Tclin)
UniProt: P10912
Structure
PDB: 

Position
5p13.1-p12
AA seq 638 aa AA seqDB search
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgaggccacagcagctatccttagcagagcaccctggagtctgcaaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcaccaagtgccgttcacctgag
cgagagactttttcatgccactggacagatgaggttcatcatggtacaaagaacctagga
cccatacagctgttctataccagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcgtttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgatgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatatccaagtgagatgggaagcaccacgcaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggaccctatattgacaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttgggctaacagtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagactgaggaatca
gacacagacagacttctaagcagtgaccatgagaaatcacatagtaacctaggggtgaag
gatggcgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctcttatgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgaaggagctgagtcaactcaccaagctgcccatattcagctaagcaatccaagttca
ctgtcaaacatcgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccgggccaaaagaataaggcagggatgtcccaatgtgacatgcacccggaaatg
gtctcactctgccaagaaaacttccttatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacatcaaggttgaatcacacatacagccaagctta
aaccaagaggacatttacatcaccacagaaagccttaccactgctgctgggaggcctggg
acaggagaacatgttccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcatgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

DBGET integrated database retrieval system