KEGG   Homo sapiens (human): 2692Help
Entry
2692              CDS       T01001                                 

Gene name
GHRHR, GHRFR, GRFR, IGHD1B, IGHD4
Definition
(RefSeq) growth hormone releasing hormone receptor
  KO
K04584  growth hormone releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00254  Growth hormone deficiency
H02035  Isolated growth hormone deficiency
Drug target
Ibutamoren mesylate: D04491
Sermorelin (DG00494): D02117 D08509
Somatorelin (DG01168): D03326 D08523
Tesamorelin (DG00495): D06655 D09015
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2692 (GHRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2692 (GHRHR)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Hypothalamic hormone
   Growth hormone-releasing hormone (GHRH)
    2692 (GHRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 2692
NCBI-ProteinID: NP_000814
OMIM: 139191
HGNC: 4266
Ensembl: ENSG00000106128
Vega: OTTHUMG00000152801
Pharos: Q02643(Tclin)
UniProt: Q02643 A0A090N8Y6
Structure
PDB: 

Position
7p14.3
AA seq 423 aa AA seqDB search
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWD
GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVF
LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRR
AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF
LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL
ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT
SMC
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccggatgtggggggcccacgtcttctgcgtgttgagcccgttaccgaccgta
ttgggccacatgcacccagaatgtgacttcatcacccagctgagagaggatgagagtgcc
tgtctacaagcagcagaggagatgcccaacaccaccctgggctgccctgcgacctgggat
gggctgctgtgctggccaacggcaggctctggcgagtgggtcaccctcccctgcccggat
ttcttctctcacttcagctcagagtcaggggctgtgaaacgggattgtactatcactggc
tggtctgagccctttccaccttaccctgtggcctgccctgtgcctctggagctgctggct
gaggaggaatcttacttctccacagtgaagattatctacaccgtgggccatagcatctct
attgtagccctcttcgtggccatcaccatcctggttgctctcaggaggctccactgcccc
cggaactacgtccacacccagctgttcaccacttttatcctcaaggcgggagctgtgttc
ctgaaggatgctgcccttttccacagcgacgacactgaccactgcagcttctccactgtt
ctatgcaaggtctctgtggccgcctcccatttcgccaccatgaccaacttcagctggctg
ttggcagaagccgtctacctgaactgcctcctggcctccacctcccccagctcaaggaga
gccttctggtggctggttctcgctggctgggggctgcccgtgctcttcactggcacgtgg
gtgagctgcaaactggccttcgaggacatcgcgtgctgggacctggacgacacctccccc
tactggtggatcatcaaagggcccattgtcctctcggtcggggtgaactttgggcttttt
ctcaatattatccgcatcctggtgaggaaactggagccagctcagggcagcctccatacc
cagtctcagtattggcgtctctccaagtcgacacttttcctgatcccactctttggaatt
cactacatcatcttcaacttcctgccagacaatgctggcctgggcatccgcctccccctg
gagctgggactgggttccttccagggcttcattgttgccatcctctactgcttcctcaac
caagaggtgaggactgagatctcacggaagtggcatggccatgaccctgagcttctgcca
gcctggaggacccgtgctaagtggaccacgccttcccgctcggcggcaaaggtgctgaca
tctatgtgctag

DBGET integrated database retrieval system