KEGG   Homo sapiens (human): 2693Help
Entry
2693              CDS       T01001                                 

Gene name
GHSR, GHDP
Definition
(RefSeq) growth hormone secretagogue receptor
  KO
K04284  growth hormone secretagogue receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Anamorelin hydrochloride: D08856
Capromorelin tartrate: D03373
Macimorelin (DG01879): D10562 D10563
Pralmorelin dihydrochloride: D02040
Relamorelin: D10660
Rismorelin porcine: D05734
Ulimorelin (DG01338): D09981 D09982
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2693 (GHSR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2693 (GHSR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Ghrelin
    2693 (GHSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 2693
NCBI-ProteinID: NP_940799
OMIM: 601898
HGNC: 4267
Ensembl: ENSG00000121853
Vega: OTTHUMG00000156946
Pharos: Q92847(Tclin)
UniProt: Q92847
Position
3q26.31
AA seq 366 aa AA seqDB search
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgcgacgcccagcgaagagccggggttcaacctcacactggccgacctggac
tgggatgcttcccccggcaacgactcgctgggcgacgagctgctgcagctcttccccgcg
ccgctgctggcgggcgtcacagccacctgcgtggcactcttcgtggtgggcatcgctggc
aacctgctcaccatgctggtggtgtcgcgcttccgcgagctgcgcaccaccaccaacctc
tacctgtccagcatggccttctccgatctgctcatcttcctctgcatgcccctggacctc
gttcgcctctggcagtaccggccctggaacttcggcgacctcctctgcaaactcttccaa
ttcgtcagtgagagctgcacctacgccacggtgctcaccatcacagcgctgagcgtcgag
cgctacttcgccatctgcttcccactccgggccaaggtggtggtcaccaaggggcgggtg
aagctggtcatcttcgtcatctgggccgtggccttctgcagcgccgggcccatcttcgtg
ctagtcggggtggagcacgagaacggcaccgacccttgggacaccaacgagtgccgcccc
accgagtttgcggtgcgctctggactgctcacggtcatggtgtgggtgtccagcatcttc
ttcttccttcctgtcttctgtctcacggtcctctacagtctcatcggcaggaagctgtgg
cggaggaggcgcggcgatgctgtcgtgggtgcctcgctcagggaccagaaccacaagcaa
accgtgaaaatgctggctgtagtggtgtttgccttcatcctctgctggctccccttccac
gtagggcgatatttattttccaaatcctttgagcctggctccttggagattgctcagatc
agccagtactgcaacctcgtgtcctttgtcctcttctacctcagtgctgccatcaacccc
attctgtacaacatcatgtccaagaagtaccgggtggcagtgttcagacttctgggattc
gaacccttctcccagagaaagctctccactctgaaagatgaaagttctcgggcctggaca
gaatctagtattaatacatga

DBGET integrated database retrieval system