KEGG   Homo sapiens (human): 2694Help
Entry
2694              CDS       T01001                                 

Gene name
GIF, IF, IFMH, INF, TCN3
Definition
(RefSeq) gastric intrinsic factor
  KO
K14615  gastric intrinsic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Disease
H01277  Vitamin B12 deficiency anaemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    2694 (GIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cobalamin_bind DUF4430
Motif
Other DBs
NCBI-GeneID: 2694
NCBI-ProteinID: NP_005133
OMIM: 609342
HGNC: 4268
Ensembl: ENSG00000134812
Vega: OTTHUMG00000167399
Pharos: P27352(Tbio)
UniProt: P27352
Structure
PDB: 

Position
11q12.1
AA seq 417 aa AA seqDB search
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIA
MNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENW
APSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLAL
TCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPS
KKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS
NPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFE
TTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtttgccctctacctcctgagccttctctgggctacagctgggactagtacc
cagacccagagttcatgctccgttccctcagcacaggagcccttggtcaatggaatacaa
gtactcatggagaactcggtgacttcatcagcctacccaaaccccagcatcctgattgcc
atgaatctggccggagcctacaacttgaaggcccagaagctcctgacttaccagctcatg
tccagcgacaacaacgatctaaccattgggcagctcggcctcaccatcatggccctcacc
tcctcctgccgagaccctggggataaagtatccattctacaaagacaaatggagaactgg
gcaccttccagccccaacgctgaagcatcagccttctatgggcccagtctagcgatcttg
gcactgtgccagaagaactctgaggcgaccttgccgatagccgtccgctttgccaagacc
ctgctggccaactcctctcccttcaatgtagacacaggagcaatggcaaccttggctctg
acctgtatgtacaacaagatccctgtaggttcagaggaaggttacagatccctgtttggt
caggtactaaaggatattgtggagaaaatcagcatgaagatcaaagataatggcatcatt
ggagacatctacagtactggcctcgccatgcaggctctctctgtaacacctgagccatct
aaaaaggaatggaactgcaagaagactacggatatgatactcaatgagattaagcagggg
aaattccacaaccccatgtccattgctcaaatcctcccttccctgaaaggcaagacatac
ctagatgtgccccaggtcacttgtagtcctgatcatgaggtacaaccaactctacccagc
aaccctggccctggccccacctctgcatctaacatcactgtcatatacaccataaataac
cagctgaggggggttgagctgctcttcaacgagaccatcaatgttagtgtgaaaagtggg
tcagtgttacttgttgtcctagaggaagcacagcgcaaaaatcctatgttcaaatttgaa
accacaatgacatcttggggccttgtcgtctcttctatcaacaatatcgcggaaaatgtt
aatcacaagacatactggcagtttcttagtggtgtaacacctttgaatgaaggggttgct
gactacatacccttcaaccacgagcacatcacagccaatttcacacagtactaa

DBGET integrated database retrieval system