KEGG   Homo sapiens (human): 26953
Entry
26953             CDS       T01001                                 
Symbol
RANBP6
Name
(RefSeq) RAN binding protein 6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Importin_rep_6 Importin_rep_4 HEAT_2 HEAT HEAT_EZ Vac14_Fab1_bd Cnd1 Importin_rep_5 RIX1 RTP1_C1
Other DBs
NCBI-GeneID: 26953
NCBI-ProteinID: NP_036548
HGNC: 9851
Ensembl: ENSG00000137040
Pharos: O60518(Tdark)
UniProt: O60518
Position
9:complement(6011025..6015624)
AA seq 1105 aa
MAATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNR
RAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKKLCDI
FAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDI
IKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFKDFADLLPGILQAVNDSCYQD
DDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATP
MLKKHTNIIAQAVPHILAMMVDLQDDEDWVNADEMEEDDFDSNAVAAESALDRLACGLGG
KVVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPH
PRVRAAACTTLGQMATDFAPNFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIED
CPKSLLVLYVDSMVKNLHSVLVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYD
IFMPSLKHIVELAVQKELKLLRGKTIECISHIGLAVGKEKFMQDASNVMQLLLKTQSDLN
NMEDDDPQTSYMVSAWARMCKILGKDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLK
FYFHDNVRVAAAESMPFLLECARIRGPEYLAQMWQFICDPLIKAIGTEPDTDVLSEIMNS
FAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDED
ECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLICSSRPWPDRQWGLCIFDDII
EHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLV
KVIKCANSKTKKNVIATENCISAIGKILKFKPNCVNVDEVLPHWLSWLPLHEDKEEAIQT
LSFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSE
DLWLECVSQLDDEQQEALQELLNFA
NT seq 3318 nt   +upstreamnt  +downstreamnt
atggcggcaaccgcgtctgcaggggtgccggcgaccgtgtcagaaaagcaagagttttac
cagcttctgaagaacctgatcaatccaagctgtatggtgcggaggcaagcagaggaaatc
tatgaaaatatcccaggtctgtgtaagactaccttcctcttagatgccgtcagaaataga
agagcaggttatgaggtgagacaaatggctgccgcactgctacgacggcttttgtcctct
gggtttgaggaggtttatccaaatctgcctgctgatgttcagagagatgtcaagattgaa
ctgattctggctgttaagttagaaacacatgctagcatgaggaaaaaactttgtgatatt
tttgcagtgctggccaggaatttgatagatgaggatggcactaaccactggccggaaggt
ctgaagtttcttattgattcaatctactccaaaaatgtggttctatgggaagttgcactt
cacgttttctggcactttcctgggatttttgggacccaagagcggcatgatttggatatc
atcaaacggttgttggaccagtgtattcaagatcaagaacatccagcaatcaggacatta
tccgctagagctgcagctgcatttgtacttgctaatgagaataatattgctcttttcaaa
gactttgcagacttgcttcctggaatcttacaggctgtgaatgactcatgctaccaggat
gatgattcagtgctagaatcccttgttgagattgcagataccgtacctaagtacttgggt
ccttatttagaagatactctacagttgagtttgaagttatgtggagactctaggcttagt
aatctgcagcgccagctggccctcgaagttatagtgaccttgtctgaaactgccactccg
atgttgaaaaaacatacaaatattattgcacaggcagttcctcatatattagcaatgatg
gttgatctacaagatgatgaggactgggtaaatgctgatgaaatggaagaagatgatttt
gacagcaatgcagttgctgcggagagtgcactagacagactggcttgtgggcttggtgga
aaagttgttttaccaatgaccaaggagcatatcatgcagatgcttcagagccctgactgg
aagtatcgacatgctggattaatggccttatctgccattggagaaggatgccatcaacaa
atggaatcaattctagatgaaacagttaactccgttttgctttttcttcaggatcctcat
ccaagggtgagggctgcagcctgtactacacttggacagatggctacagattttgcacct
aatttccaaaagaaatttcatgaaacagtgattgcagctctgttacgtaccatggaaaat
caaggtaatcagcgtgtgcaatcacatgcagcttctgctcttattatttttattgaagac
tgccctaaatcattgctagttctatatgtggatagtatggtgaaaaatctacattccgtc
ttggtgattaaacttcaagagttgattcggaatggaactaagttggctttggaacaactt
gtgacaaccattgcatcagttgcagatacaatagaagaaaaatttgtcccatattatgat
atattcatgccctcactaaagcacattgttgagcttgctgttcagaaggaactcaagctt
ctgagaggaaaaactatcgagtgcattagccatattggtcttgctgttgggaaggaaaaa
tttatgcaagatgcatcaaatgtgatgcagctgttgttgaagacacaatcagacttaaat
aatatggaagatgatgaccctcagacctcttacatggtttcagcatgggctagaatgtgt
aaaattcttggaaaagattttcaacagtaccttccactggttatcgagcctcttattaag
actgcttcagctaaacctgatgttgctctcttagacacacaggatgtggaaaatatgagt
gacgatgatggctggcaatttgtaaatcttggagaccagcagagttttggaattaaaact
tcaggacttgaagcaaaagcaactgcttgccaaatgttggtttactatgctaaggagtta
agggaagggtttgtggaatatacagaacaagttgtgaagctgatggttcctttactgaaa
ttttatttccatgacaatgttcgagtggcagcagcagagtccatgccttttctcctggaa
tgtgcaagaattcgtggcccagagtatcttgcacagatgtggcaattcatatgtgacccc
ttaatcaaggctattggtactgaaccagatacagatgtgctctcagaaataatgaattct
tttgcaaagtccattgaagttatgggagatggttgccttaatgatgaacacttggaagaa
ctgggaggaatactgaaagcaaaacttgaagggcactttaaaaaccaagaattgagacag
gtgaaaagacaggaagaaaactatgatcaacaggttgagatgtctctgcaagatgaggat
gaatgtgatgtttatattctgaccaaagtatcagatattttgcactcattatttagtact
tataaggaaaagattttaccatggtttgaacaactacttccattaattgtaaatctaatt
tgttcaagtaggccatggccagacagacagtggggattgtgcatatttgatgacatcata
gagcactgcagtccaacttcatttaaatatgtagaatattttcggtggccaatgctacta
aatatgcgagataacaaccctgaagtcaggcaagctgctgcttatggcctgggtgtcatg
gcacagtttggtggagatgattatcgttctttatgttcagaagctgttccacttctggta
aaagttattaagtgtgcaaattccaaaaccaaaaaaaatgtcattgctacagagaactgt
atctcagcaatagggaagattttgaagtttaagcctaactgtgtaaatgtagatgaagtt
cttccacactggttatcatggcttccactgcatgaagataaagaggaagctattcagact
ttgagttttctctgtgacctaattgaaagtaaccacccagttgtaattggtccaaataat
tccaatcttcccaaaataatcagtataattgcagaaggaaaaattaatgagactattaac
tatgaggatccttgtgccaaacgcctagctaatgtcgtgcgtcaggtacagacttctgaa
gatttatggttggaatgtgtatcacaacttgatgatgaacagcaggaagccttacaggag
ttgctaaattttgcttga

DBGET integrated database retrieval system