KEGG   Homo sapiens (human): 26958Help
Entry
26958             CDS       T01001                                 

Gene name
COPG2, 2-COP, gamma-2-COP
Definition
(RefSeq) coatomer protein complex subunit gamma 2
  KO
K17267  coatomer subunit gamma
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26958 (COPG2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    26958 (COPG2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    26958 (COPG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26958 (COPG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 HEAT_EZ HEAT MOR2-PAG1_C UNC45-central PuR_N
Motif
Other DBs
NCBI-GeneID: 26958
NCBI-ProteinID: NP_036265
OMIM: 604355
HGNC: 2237
Ensembl: ENSG00000158623
Vega: OTTHUMG00000155364
Pharos: Q9UBF2(Tdark)
UniProt: Q9UBF2 A0A140VK12
Position
7q32.2
AA seq 871 aa AA seqDB search
MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEH
FGTTEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVY
RGPAIRALCRITDGTMLQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINE
AQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLL
KETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRL
MKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRV
VLENEAVRAAAVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQM
ALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKP
EKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQF
DCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGS
FSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTF
EKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVR
SRLALADGVTMQVTVRSKERTPVDVILASVG
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattcgacaagaaggacgaggagtctggtagtggctccaatcctttccag
catctggagaagagtgctgttttacaggaggctcgtatattcaatgaaactccaatcaat
ccaagaagatgtttgcatattcttacaaagattctttacttactgaaccagggtgaacac
tttggaacaacggaagctacagaagccttctttgcaatgacgcgattgtttcaatctaat
gatcaaacattgaggagaatgtgctaccttaccatcaaagaaatggctaccatctctgag
gatgtgataattgtcacaagcagtctgactaaagacatgactggaaaagaagatgtatac
cgaggcccggccatcagagctctctgcaggatcaccgatggaacaatgttgcaagccatt
gaaagatacatgaagcaggccattgtggataaagtttccagtgtatccagttcagcactg
gtatcttccctgcacatgatgaagataagctatgatgtggttaagcgctggatcaatgaa
gcccaagaagctgcatcaagtgataatattatggtccagtaccatgcattgggagtcctg
tatcaccttagaaagaatgatcgacttgctgtttccaagatgttgaataagtttactaaa
tctggtctcaagtcacagtttgcttactgcatgctgatccgaattgccagtcgcttacta
aaagaaactgaggatggccatgaaagtccactgtttgatttcattgagagctgcttgcga
aataaacatgaaatggttatttatgaagctgcttcagctatcatccatcttcctaactgc
actgcaagagagttggcacctgctgtttcagttcttcaacttttctgtagttctcctaag
ccagccttgagatatgcagctgtgaggaccttgaacaaggtggcaatgaagcacccctct
gctgttactgcctgcaatctggacttagaaaacttaatcacagactcaaacagaagcatt
gctaccttagccattactacactcctcaaaacaggaagtgagagcagtgtggaccggctc
atgaagcagatatcttcttttgtgtctgaaatctcagatgagttcaaggtggtggttgta
caggcaattagtgctctctgtcagaaataccctcgaaagcacagtgtcatgatgactttc
ctctccaacatgctccgagatgatggaggctttgagtacaagcgggccattgtggactgt
ataatcagcattgtggaagagaaccctgagagtaaagaagcaggcctagcccacctttgt
gaattcattgaggactgtgaacacactgttctggctactaagattctacacttgttgggc
aaagagggccctagaacgcctgtcccctccaaatatatccgttttatttttaatagggtt
gtcctggagaatgaggctgtcagagctgctgctgtgagtgctttggctaaatttggggct
cagaatgagagtcttctcccaagcatccttgtactcttacagaggtgtatgatggatact
gatgacgaggtacgagacagagctaccttctatctgaatgtgctgcagcagaggcagatg
gcactaaatgccacatatatctttaatggtttgacggtctctgtaccagggatggaaaaa
gccttacaccagtacacgttggagccttcagaaaaaccgtttgacatgaaatcaattcct
cttgctatggctcctgtctttgaacagaaagcagaaatcacacttgtggctactaagcca
gagaagttggctccttccaggcaagacattttccaagaacaattggctgccattcctgag
tttctgaatataggacccttgttcaagtcttctgagcctgttcaacttacagaagcagag
acagaatattttgttcgatgtatcaagcacatgtttaccaatcacatcgtgttccagttt
gactgcaccaacactctcaatgaccagctgctggaaaaagtgacagtgcagatggagcca
tcagattcctatgaagtgctgtcttgtatcccagcccccagccttccttataaccaacca
ggaatatgttacactcttgttcgtttgcctgatgatgaccctacagcagttgcaggctcc
tttagctgcaccatgaagtttacagtccgggactgtgaccctaacactggagttccagat
gaggatgggtatgatgatgagtatgtgctggaagatctcgaagtgactgtgtctgaccat
attcagaaagtactgaagcctaactttgctgctgcttgggaagaggtgggagataccttt
gagaaagaggaaacctttgccctcagttctaccaaaacccttgaagaggctgtcaacaat
atcatcacatttctgggcatgcagccatgtgagaggtccgataaagtacctgagaacaag
aattcccattcgctctatctggcaggtatattcagaggtggctatgatttattggtgagg
tccaggctggccttagccgatggagtgaccatgcaggtgactgtcagaagtaaagagaga
acacctgtagatgttatcttagcttctgttggataa

DBGET integrated database retrieval system