KEGG   Homo sapiens (human): 26959
Entry
26959             CDS       T01001                                 
Symbol
HBP1
Name
(RefSeq) HMG-box transcription factor 1
  KO
K21644  HMG box transcription factor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    26959 (HBP1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    26959 (HBP1)
SSDB
Motif
Pfam: AXH HMG_box HMG_box_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 26959
NCBI-ProteinID: NP_036389
OMIM: 616714
HGNC: 23200
Ensembl: ENSG00000105856
Pharos: O60381(Tbio)
UniProt: O60381 A0A024R722
Structure
Position
7:107169003..107202522
AA seq 514 aa
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLP
ELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATS
PQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHER
ANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARA
EGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDH
PFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFT
PMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN
HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEER
RMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggtgtgggaagtgaagacaaatcagatgcctaatgcagtacagaaactcctgttggtg
atggacaagagagcctcaggaatgaatgactcattggagttgctgcagtgtaatgagaat
ttgccatcttcacctggatataactcctgtgatgaacacatggagcttgatgaccttcct
gaacttcaggcagttcaaagtgatcctacccaatctggcatgtaccagctgagttcagat
gtttcacatcaagaatacccaagatcatcttggaaccaaaatacctcagacataccagaa
actacttaccgtgaaaatgaggtggactggctaacagaattggcaaatatcgcgaccagt
ccacaaagtccactgatgcagtgctcattttacaatagatcatctcctgtacacatcata
gccactagcaaaagtttacattcctatgcacgccctccaccagtgtcctcttcttcgaag
agtgaaccagccttccctcatcaccattggaaggaggaaacaccagtaagacacgaaagg
gcaaatagtgagtcagaatctggcattttctgcatgtcctccctgtcagatgatgatgat
ttgggatggtgcaattcctggccttcaactgtctggcactgttttttgaaaggcacacga
ctgtgctttcataagggaagcaataaggaatggcaagatgttgaagattttgctagagct
gaaggctgtgataatgaggaagatcttcaaatgggcattcacaagggctatggttctgat
ggtctaaagttgttatcacatgaagaaagtgtatcatttggcgagtctgtactgaagttg
acttttgatcctggtacagtagaagatggtttacttaccgtagagtgtaagctggaccac
cctttctatgttaaaaataaaggttggtcatcattttatccaagcttgactgtggtacag
catggcattccatgttgtgaagttcatattggcgatgtatgtctacctcctggacacccc
gatgccattaattttgatgattcaggtgtttttgatacatttaaaagctatgacttcaca
cctatggattcttctgcagtttatgtgttaagtagtatggctcgccagcgtcgtgcatct
ttgtcttgtggaggacctggtggtcaagactttgcaagatctggattcagtaaaaactgt
ggctcacctggatcatcacagctctcttccaattctttgtatgctaaagctgtcaaaaac
cacagctcagggactgtgagtgccacttctcctaataagtgcaaaagaccaatgaatgcc
ttcatgctttttgccaaaaaatacagagttgaatatactcagatgtatccagggaaagat
aacagagccataagtgtgatccttggtgacaggtggaagaaaatgaagaatgaagagaga
agaatgtacacattagaagcaaaggctttggctgaagaacagaaacgtttaaatcctgac
tgttggaagaggaaaagaaccaattcaggctcacaacaacattaa

DBGET integrated database retrieval system