KEGG   Homo sapiens (human): 2696Help
Entry
2696              CDS       T01001                                 

Gene name
GIPR, PGQTL2
Definition
(RefSeq) gastric inhibitory polypeptide receptor
  KO
K04580  gastric inhibitory polypeptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Tirzepatide: D11360
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2696 (GIPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2696 (GIPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2696 (GIPR)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Gastric inhibitory peptide (GIP)
    2696 (GIPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 2696
NCBI-ProteinID: NP_000155
OMIM: 137241
HGNC: 4271
Ensembl: ENSG00000010310
Vega: OTTHUMG00000182129
Pharos: P48546(Tchem)
UniProt: P48546
Structure
PDB: 

Position
19q13.32
AA seq 466 aa AA seqDB search
MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLA
CNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCEN
PEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSF
MLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVY
LHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPV
TEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctccgatcctgcagctgctgctgcggctctcactgtgcgggctgctgctc
cagagggcggagacaggctctaaggggcagacggcgggggagctgtaccagcgctgggaa
cggtaccgcagggagtgccaggagaccttggcagccgcggaaccgccttcaggcctcgcc
tgtaacgggtccttcgatatgtacgtctgctgggactatgctgcacccaatgccactgcc
cgtgcgtcctgcccctggtacctgccctggcaccaccatgtggctgcaggtttcgtcctc
cgccagtgtggcagtgatggccaatggggactttggagagaccatacacaatgtgagaac
ccagagaagaatgaggcctttctggaccaaaggctcatcttggagcggttgcaggtcatg
tacactgtcggctactccctgtctctcgccacactgctgctagccctgctcatcttgagt
ttgttcaggcggctacattgcactagaaactatatccacatcaacctgttcacgtctttc
atgctgcgagctgcggccattctcagccgagaccgtctgctacctcgacctggcccctac
cttggggaccaggcccttgcgctgtggaaccaggccctcgctgcctgccgcacggcccag
atcgtgacccagtactgcgtgggtgccaactacacgtggctgctggtggagggcgtctac
ctgcacagtctcctggtgctcgtgggaggctccgaggagggccacttccgctactacctg
ctcctcggctggggggcccccgcgcttttcgtcattccctgggtgatcgtcaggtacctg
tacgagaacacgcagtgctgggagcgcaacgaagtcaaggccatttggtggattatacgg
acccccatcctcatgaccatcttgattaatttcctcatttttatccgcattcttggcatt
ctcctgtccaagctgaggacacggcaaatgcgctgccgggattaccggctgaggctggct
cgctccacgctgacgctggtgcccctgctgggtgtccacgaggtggtgtttgctcccgtg
acagaggaacaggcccggggcgccctgcgcttcgccaagctcggctttgagatcttcctc
agctccttccagggcttcctggtcagcgtcctctactgcttcatcaacaaggaggtgcag
tcggagatccgccgtggctggcaccactgccgcctgcgccgcagcctgggcgaggagcaa
cgccagctcccggagcgcgccttccgggccctgccctccggctccggcccgggcgaggtc
cccaccagccgcggcttgtcctcggggaccctcccagggcctgggaatgaggccagccgg
gagttggaaagttactgctag

DBGET integrated database retrieval system