KEGG   Homo sapiens (human): 26973
Entry
26973             CDS       T01001                                 
Symbol
CHORDC1, CHP1
Name
(RefSeq) cysteine and histidine rich domain containing 1
  KO
K16729  cysteine and histidine-rich domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    26973 (CHORDC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    26973 (CHORDC1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   26973 (CHORDC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     26973 (CHORDC1)
SSDB
Motif
Pfam: CHORD CS
Other DBs
NCBI-GeneID: 26973
NCBI-ProteinID: NP_036256
OMIM: 604353
HGNC: 14525
Ensembl: ENSG00000110172
Pharos: Q9UHD1(Tbio)
UniProt: Q9UHD1
Structure
Position
11:complement(90200429..90223049)
AA seq 332 aa
MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCT
KGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLEL
KISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHS
GVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGE
VTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI
EITMRKAEPMQWASLELPAAKKQEKQKDATTD
NT seq 999 nt   +upstreamnt  +downstreamnt
atggccttgctgtgctacaaccggggctgcggtcagcgcttcgatcctgagaccaattcc
gacgatgcttgcacataccacccaggtgttccggtctttcacgatgcattaaagggttgg
tcttgctgtaagagaagaacaactgatttttctgatttcttaagcattgtaggctgtaca
aaaggtagacataatagtgagaagccacctgagccagtcaaacctgaagtcaagactact
gagaagaaggagctatgtgaattaaaacccaaatttcaggaacacatcattcaagcccct
aagccagtagaagcaataaaaagaccaagcccagatgaaccaatgacaaatttggaatta
aaaatatctgcctccctaaaacaagcacttgataaacttaaactgtcatcagggaatgaa
gaaaataagaaagaagaagacaatgatgaaattaagattgggacctcatgtaagaatgga
gggtgttcaaagacataccagggtctagagagtctagaagaagtctgtgtatatcattct
ggagtacctattttccatgaggggatgaaatactggagctgttgtagaagaaaaacttct
gattttaatacattcttagcccaagagggctgtacaaaagggaaacacatgtggactaaa
aaagatgctgggaaaaaagttgttccatgtagacatgactggcatcagactggaggtgaa
gttaccatttcagtatatgctaaaaactcacttccagaacttagccgagtagaagcaaat
agcacattgttaaatgtgcatattgtatttgaaggagagaaggaatttgatcaaaatgtg
aaattatggggtgtgattgatgtaaagcgaagttatgtaactatgactgcaacaaagatt
gaaatcactatgagaaaagctgaaccgatgcagtgggcaagccttgaactgcctgcagct
aaaaagcaggaaaaacaaaaagatgccacaacagattga

DBGET integrated database retrieval system