KEGG   Homo sapiens (human): 26985
Entry
26985             CDS       T01001                                 
Symbol
AP3M1
Name
(RefSeq) adaptor related protein complex 3 subunit mu 1
  KO
K12398  AP-3 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    26985 (AP3M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26985 (AP3M1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    26985 (AP3M1)
 Endosome - Golgi transport
    26985 (AP3M1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 26985
NCBI-ProteinID: NP_001307192
OMIM: 610366
HGNC: 569
Ensembl: ENSG00000185009
Pharos: Q9Y2T2(Tbio)
UniProt: Q9Y2T2 A0A024QZR5
Position
10:complement(74120255..74150828)
AA seq 418 aa
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIY
RDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNG
FPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAY
FDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFK
RWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQN
MGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNL
QSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatccacagtctatttctcataaactgttccggtgacatatttctagagaagcactgg
aagagcgttgtgagccagtctgtctgtgattatttctttgaagctcaagagaaagctgct
gatgttgaaaatgtaccacctgtcatttcaacacctcaccactacctcatcagtatctac
cgggataagctcttctttgtatctgtcatacagaccgaagtgccacctctctttgtaatt
gagttcctacatcgagttgctgacacttttcaggactactttggtgagtgttcagaggct
gcaattaaggataatgtggtcatagtatatgaactcttagaagaaatgttagacaatgga
tttccactggctaccgaatctaacattttgaaagaattgattaaaccaccaacaattcta
cgctctgttgtcaactctattacaggcagtagtaatgttggggacacactccccaccggg
cagctgtccaacataccatggcgtcgggcaggggtaaagtacacaaacaatgaagcctat
tttgatgttgttgaagaaatagacgcaattatagataaatcaggatctacagtctttgca
gaaattcagggggtcattgatgcttgcattaaactatctggaatgcctgatctctccctt
tctttcatgaaccctaggcttctggatgatgtcagctttcacccctgcatccggttcaag
cgttgggaatctgaaagagttttgtcatttattcctccagatggaaatttccgactcata
tcataccgtgtcagctcacaaaatctagtggcaataccagtgtatgtgaaacatagtatc
agctttaaggagaacagttcttgcggcagatttgatataacaattggaccaaagcagaat
atggggaaaactattgaaggaattacagtgacagttcacatgccaaaagttgtgctgaac
atgaacctgacacccacacaaggcagctatacatttgatccagtcaccaaggtactaaca
tgggatgtgggaaaaattactccacaaaagctcccaagtcttaaaggactggtaaattta
cagtctggagcccccaaaccagaagagaatccgagcctcaacatacagtttaagatccag
cagcttgctatttcaggcttaaaagtaaaccgtttggacatgtatggggagaaatataag
ccatttaaaggagtcaaatacgtcacgaaagctggaaagttccaagtgaggacatga

DBGET integrated database retrieval system