KEGG   Homo sapiens (human): 26993
Entry
26993             CDS       T01001                                 

Gene name
AKAP8L, HA95, HAP95, NAKAP, NAKAP95
Definition
(RefSeq) A-kinase anchoring protein 8 like
  KO
K15978  A-kinase anchor protein 8-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    26993 (AKAP8L)
SSDB
Motif
Pfam: AKAP95 Actin_micro zf-met
Other DBs
NCBI-GeneID: 26993
NCBI-ProteinID: NP_055186
OMIM: 609475
HGNC: 29857
Ensembl: ENSG00000011243
Vega: OTTHUMG00000182446
Pharos: Q9ULX6(Tbio)
UniProt: Q9ULX6
Position
19p13.12
AA seq 646 aa
MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYG
YGMATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGE
RYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRA
QGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGG
AFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDEPDSKATRTDCSDNS
DSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKGALTTQDENGQ
TKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVE
AAHCAACDLFIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLE
RYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAV
SPPPPPPPEEEEEGAVPLLGGALQRQIRGIPGLDVEDDEEGGGGAP
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagctacacaggctttgtccagggatctgaaaccactttgcagtcgacatactcggat
accagcgctcagcccacctgtgattatggatatggaacttggaactctgggacaaataga
ggctacgagggctatggctatggctatggctatggccaggataacaccaccaactatggg
tatggtatggccacttcacactcttgggaaatgcctagctctgacacaaatgcaaacact
agtgcctcgggtagcgccagtgccgattccgttttatccagaattaaccagcgcttagat
atggtgccgcatttggagacagacatgatgcaaggaggcgtgtacggctcaggtggagaa
aggtatgactcttatgagtcctgcgactcgagggccgtcctgagtgagcgcgacctgtac
cggtcaggctatgactacagcgagcttgaccctgagatggaaatggcctatgagggccaa
tacgatgcctaccgcgaccagttccgcatgcgtggcaacgacaccttcggtcccagggca
cagggctgggcccgggatgcccggagcggccggccaatggcctcaggctatgggcgcatg
tgggaagaccccatgggggcccggggccagtgcatgtctggtgcctctcggctgccctcc
ctcttctcccagaacatcatccccgagtacggcatgttccagggcatgcgaggtgggggc
gccttcccgggcggctcccgctttggtttcgggtttggcaatggcatgaagcagatgagg
cggacctggaagacctggaccacagccgacttccgaaccaagaagaagaagagaaagcag
ggcggcagtcctgatgagccagatagcaaagccacccgcacggactgctcggacaacagc
gactcagacaatgatgagggcaccgagggggaagccacagagggccttgaaggcaccgag
gctgtggagaagggctccagagtggacggagaggatgaggagggaaaagaggatgggaga
gaagaaggcaaagaggatccagagaagggggccctaaccacccaggatgaaaatggccag
accaagcgcaagttgcaggcaggcaagaagagtcaggacaagcagaaaaagcggcagcga
gaccgcatggtggaaaggatccagtttgtgtgttctctgtgcaaataccggaccttctat
gaggacgagatggccagccatcttgacagcaagttccacaaggaacactttaagtacgta
ggcaccaagctccctaagcagacggctgactttctgcaggagtacgtcactaacaagacc
aagaagacagaggagctccgaaaaaccgtggaggaccttgatggcctcatccagcaaatc
tacagagaccaggatctgacccaggaaattgccatggagcattttgtgaagaaggtggag
gcagcccattgtgcagcctgcgacctcttcattcccatgcagtttgggatcatccagaag
catctgaagaccatggatcacaaccggaaccgcaggctcatgatggagcagtccaagaag
tcctccctcatggtggcccgcagtattctcaacaacaagctcatcagcaagaagctggag
cgctacctgaagggcgagaaccctttcaccgacagccccgaggaggagaaggagcaggag
gaggctgagggcggtgccctggacgagggggcgcagggcgaagcggcagggatctcggag
ggcgcagagggcgtgccggcgcagcctcccgtgcccccagagccagcccccggggccgtg
tcgccgccaccgccgccgcccccagaggaggaggaggagggcgccgtgcccttgctggga
ggggcgctgcaacgccagatccgcggcatcccgggcctcgacgtggaggacgacgaggag
ggcggcgggggcgccccgtga

DBGET integrated database retrieval system