KEGG   Homo sapiens (human): 26995Help
Entry
26995             CDS       T01001                                 

Gene name
TRUB2, CLONE24922
Definition
(RefSeq) TruB pseudouridine synthase family member 2
  KO
K23497  mitochondrial mRNA pseudouridine synthase TRUB2 [EC:5.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    26995 (TRUB2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     26995 (TRUB2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    26995 (TRUB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TruB_N TruB_C_2 PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 26995
NCBI-ProteinID: NP_056494
OMIM: 610727
HGNC: 17170
Ensembl: ENSG00000167112
Vega: OTTHUMG00000020741
Pharos: O95900(Tdark)
UniProt: O95900 A0A024R886
Position
9q34.11
AA seq 331 aa AA seqDB search
MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGS
EEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMY
NAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYS
NLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVH
EIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSP
GLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgctggcttgtcgcggctgcatgggcttttcgcggtctataagcccccgggg
ctaaaatggaagcacctgcgggatacagtggagctacaacttctgaagggtctcaatgcc
aggaagcctcccgctcctaaacagcgtgttcgcttcttgctgggccccatggaaggcagc
gaagagaaggagctgaccctcacagccaccagcgtaccctctttcatcaaccatccactg
gtatgtggaccagcattcgcccatctcaaggttggcgtgggacatcggttggatgcccag
gcttctggagtacttgtgctcggcgtgggacatggatgcaggctcctcaccgatatgtac
aatgctcatcttaccaaggattacacagtgcgtggcctcctgggcaaagctacagatgac
ttccgtgaggacgggaggctggtagagaagacaacctatgaccacgtgaccagagagaag
ctggaccgcattctggccgttatccaaggctcccatcagaaggccctggtgatgtactcc
aacctcgacctgaagacccaggaggcctatgagatggccgtgagaggcctgatccggccc
atgaacaagtccccgatgctgataactggcatccgatgcctctactttgcacctccggaa
ttcctcttagaggtgcagtgcatgcatgagacgcagaaagagctgcggaagttggttcat
gaaatcggcctggaactaaagaccactgctgtctgcacccaagtgcggcgcacgcgcgac
ggcttcttcacgctagacagtgccctcctgaggacccagtgggacctaaccaacatccag
gatgctatccgggctgctacccctcaggtagctgcagagctggagaagagcttgagcccg
gggctggacaccaagcagctccccagtccgggatggtcctgggactcccagggcccgagc
tctaccttggggctggagaggggtgcggggcagtga

DBGET integrated database retrieval system