KEGG   Homo sapiens (human): 2701
Entry
2701              CDS       T01001                                 

Symbol
GJA4, CX37
Name
(RefSeq) gap junction protein alpha 4
  KO
K07613  gap junction alpha-4 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2701 (GJA4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2701 (GJA4)
SSDB
Motif
Pfam: Connexin Connexin43
Other DBs
NCBI-GeneID: 2701
NCBI-ProteinID: NP_002051
OMIM: 121012
HGNC: 4278
Ensembl: ENSG00000187513
Vega: OTTHUMG00000004050
Pharos: P35212(Tbio)
UniProt: P35212
Position
1p34.3
AA seq 333 aa
MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPG
CTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD
PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWT
MEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM
RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERL
ASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgggtgactggggcttcctggagaagttgctggaccaggtccaggagcactcgaccgtg
gtgggtaagatctggctgacggtgctcttcatcttccgcatcctcatcctgggcctggcc
ggcgagtcagtgtggggtgacgagcaatcagatttcgagtgtaacacggcccagccaggc
tgcaccaacgtctgctatgaccaggccttccccatctcccacatccgctactgggtgctg
cagttcctcttcgtcagcacacccaccctggtctacctgggccatgtcatttacctgtct
cggcgagaagagcggctgcggcagaaggagggggagctgcgggcactgccggccaaggac
ccacaggtggagcgggcgctggcggccgtagagcgtcagatggccaagatctcggtggca
gaagatggtcgcctgcgcatccgcggagcactgatgggcacctatgtcgccagtgtgctc
tgcaagagtgtgctagaggcaggcttcctctatggccagtggcgcctgtacggctggacc
atggagcccgtgtttgtgtgccagcgagcaccctgcccctacctcgtggactgctttgtc
tctcgccccacggagaagaccatcttcatcatcttcatgttggtggttggactcatctcc
ctggtgcttaacctgctggagttggtgcacctgctgtgtcgctgcctcagccgggggatg
agggcacggcaaggccaagacgcacccccgacccagggcacctcctcagacccttacacg
gaccaggtcttcttctacctccccgtgggccaggggccctcatccccaccatgccccacc
tacaatgggctctcatccagtgagcagaactgggccaacctgaccacagaggagaggctg
gcgtcttccaggccccctctcttcctggacccaccccctcagaatggccaaaaaccccca
agtcgtcccagcagctctgcttctaagaagcagtatgtatag

DBGET integrated database retrieval system