KEGG   Homo sapiens (human): 27013
Entry
27013             CDS       T01001                                 
Symbol
CNPPD1, C2orf24, CGI-57
Name
(RefSeq) cyclin Pas1/PHO80 domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cyclin Cyclin_N
Other DBs
NCBI-GeneID: 27013
NCBI-ProteinID: NP_001308318
HGNC: 25220
Ensembl: ENSG00000115649
Pharos: Q9BV87(Tdark)
UniProt: Q9BV87 A0A024R432
Position
2:complement(219171897..219178156)
AA seq 410 aa
MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD
IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS
DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE
IFEVLSWLESCVAEQQGRWRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV
SSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEPCIPSVPQCLPSLANVSSCLE
GSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCHACLHPNRTVP
TALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggacctgaccgggctcctgctggacgaagaaggcaccttctccctcgccggcttccag
gacttcacgttcctcccaggacaccagaagctgagtgcccggatccgaaggaggctctac
tatggctgggactgggaagccgactgtagcctggaggagctctccagcccggtggcagac
attgctgtcgaactgctccagaaggcagcccccagccctattcgccgactccagaagaaa
tatgtagctcatgtgtcccgggaggcatgcatctccccatgtgctatgatgctggctctg
gtgtacattgaacggctccggcaccgaaacccagactacttgcagcatgtgtcatcctct
gacttgttcctgatctccatgatggtggccagtaagtacctctatgatgaaggggaggag
gaggaggtcttcaacgacgaatggggagctgctgggggtgtggccgtgcccactctcaat
gccttggagaggggcttcctgagtgccatggattggcatctctacactgaccctcgggag
atctttgaggtgctgagctggttggagagctgtgtggctgagcagcagggacggtggcga
ggctggtacacctacacagacctgtgtgtgctgctggagcagccgacctggcagttggcc
ctgggctccctctgccagcggctggtaaagctgtcttgcctgttagctgtggcatatgtg
agcagtgtggccctggctgtggcatcggtggccgtaatacatcagtctttggggctgtcc
tgcatccctacacctgggccgcctgaccttggactgacctcccgttgcctcctggagccc
tgcataccttctgtgccacaatgcctgccgtctctcgctaatgtctccagctgcctggaa
ggcagcatggggctgcggtcactctggggcagtcttctggcctcactgactcctccacca
ttgcctcccccagacccccctgcccctcccactcttcttcataactgccacctttgccag
aagctccagagagactccccaacctgccatgcctgcctccaccccaaccgtacagtcccc
actgcgctgtccagcccctggtaccatacctatggcctggctcccccctggccttggagc
ccggtgctcctttcacttcctcagcctcagcaatgttcccttttcagtgtcatggagctg
gctcgcctcaagtctttcgttttcccaggctag

DBGET integrated database retrieval system