KEGG   Homo sapiens (human): 27020Help
Entry
27020             CDS       T01001                                 

Gene name
NPTN, GP55, GP65, SDFR1, SDR1, np55, np65
Definition
(RefSeq) neuroplastin
  KO
K22653  neuroplastin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    27020 (NPTN)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Neuroplastin
   27020 (NPTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_4 Ig_6 Ig_5 C2-set
Motif
Other DBs
NCBI-GeneID: 27020
NCBI-ProteinID: NP_036560
OMIM: 612820
HGNC: 17867
Ensembl: ENSG00000156642
Vega: OTTHUMG00000137586
Pharos: Q9Y639(Tbio)
UniProt: Q9Y639
Structure
PDB: 

Position
15q24.1
AA seq 398 aa AA seqDB search
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLT
YSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDI
TGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgtcgctgcccagcgccctggccctctcgctgttgctggtctctggctcc
ctcctcccagggccaggcgccgctcagaacgctgggtttgtcaagtcgcccatgtcagaa
actaagctcacgggggacgcctttgagctgtactgtgacgtggtcgggagccccacgcca
gagatccagtggtggtacgcagaagtcaaccgggcagagtctttcagacagctgtgggac
ggtgctcggaagcgccgtgtcaccgtaaacaccgcctacgggtcaaacggcgtgagtgtg
ctgagaataacccggctcaccttggaggactctgggacttacgagtgcagggccagcaac
gaccccaagaggaatgacttgaggcaaaacccctccataacatggattcgagcccaggcc
accataagcgtccttcagaagccaaggattgtcaccagtgaagaggtcattattcgagac
agccctgttctccctgtcaccctgcagtgtaacctcacctccagctctcacacccttaca
tacagctactggacaaagaatggggtggaactgagtgccactcgtaagaatgccagcaac
atggagtacaggatcaataagccgagagctgaggattcaggcgaataccactgcgtatat
cactttgtcagcgctcctaaagcaaacgccaccattgaagtgaaagccgctcctgacatc
actggccataaacggagtgagaacaagaatgaagggcaggatgccactatgtattgcaag
tcagttggctacccccacccagactggatatggcgcaagaaggagaacgggatgcccatg
gacattgtcaatacctctggccgcttcttcatcatcaacaaggaaaattacactgagttg
aacattgtgaacctgcagatcacggaagaccctggcgagtatgaatgtaatgccaccaac
gccattggctccgcctctgttgtcactgtcctcagggtgcggagccacctggccccactc
tggcctttcttgggaattctggctgaaattatcatccttgtggtgatcattgttgtgtat
gagaagaggaagaggccagatgaggttcctgacgatgatgaaccagctggaccaatgaaa
accaactctaccaacaatcacaaagataaaaacttgcgccagagaaacacaaattaa

DBGET integrated database retrieval system