KEGG   Homo sapiens (human): 2703Help
Entry
2703              CDS       T01001                                 

Gene name
GJA8, CAE, CAE1, CTRCT1, CX50, CZP1, MP70
Definition
(RefSeq) gap junction protein alpha 8
  KO
K07617  gap junction alpha-8 protein
Organism
hsa  Homo sapiens (human)
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2703 (GJA8)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2703 (GJA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin Connexin50 Connexin40_C
Motif
Other DBs
NCBI-GeneID: 2703
NCBI-ProteinID: NP_005258
OMIM: 600897
HGNC: 4281
Ensembl: ENSG00000121634
Vega: OTTHUMG00000024085
Pharos: P48165(Tbio)
UniProt: P48165 X5D7G1
Position
1q21.2
AA seq 433 aa AA seqDB search
MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPG
CENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGT
NGGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPL
YRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALKRPV
EQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQF
EEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEE
QEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLS
KASSRARSDDLTV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggagtttcctggggaacatcttggaggaggtgaatgagcactccaccgtc
atcggcagagtctggctcaccgtgcttttcatcttccggatcctcatccttggcacggcc
gcagagttcgtgtggggggatgagcaatccgacttcgtgtgcaacacccagcagcctggc
tgcgagaacgtctgctacgacgaggcctttcccatctcccacattcgcctctgggtgctg
cagatcatcttcgtctccaccccgtccctgatgtacgtggggcacgcggtgcactacgtc
cgcatggaggagaagcgcaaaagccgcgaggcggaggagctgggccagcaggcggggact
aacggcggcccggaccagggcagcgtcaagaagagcagcggcagcaaaggcactaagaag
ttccggctggaggggaccctgctgaggacctacatctgccacatcatcttcaagaccctc
tttgaagtgggcttcatcgtgggccactacttcctgtacgggttccggatcctgcctctg
taccgctgcagccggtggccctgccccaatgtggtggactgcttcgtgtcccggcccacg
gagaaaaccatcttcatcctgttcatgttgtctgtggcctctgtgtccctattcctcaac
gtgatggagttgggccacctgggcctgaaggggatccggtctgccttgaagaggcctgta
gagcagcccctgggggagattcctgagaaatccctccactccattgctgtctcctccatc
cagaaagccaagggctatcagctcctagaagaagagaaaatcgtttcccactatttcccc
ttgaccgaggttgggatggtggagaccagcccactgcctgccaagcctttcaatcagttc
gaggagaagatcagcacaggacccctgggggacttgtcccggggctaccaagagacactg
ccttcctacgctcaggtgggggcacaagaagtggagggcgaggggccgcctgcagaggag
ggagccgaacccgaggtgggagagaagaaggaggaagcagagaggctgaccacggaggag
caggagaaggtggccgtgccagagggggagaaagtagagacccccggagtggataaggag
ggtgaaaaagaagagccgcagtcggagaaggtgtcaaagcaagggctgccagctgagaag
acaccttcactctgtccagagctgacaacagatgatgccagacccctgagcaggctaagc
aaagccagcagccgagccaggtcagacgatctaaccgtatga

DBGET integrated database retrieval system