KEGG   Homo sapiens (human): 27032
Entry
27032             CDS       T01001                                 

Gene name
ATP2C1, ATP2C1A, BCPM, HHD, PMR1, SPCA1, hSPCA1
Definition
(RefSeq) ATPase secretory pathway Ca2+ transporting 1
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Disease
H00844  Familial benign chronic pemphigus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    27032 (ATP2C1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     27032 (ATP2C1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 27032
NCBI-ProteinID: NP_001186108
OMIM: 604384
HGNC: 13211
Ensembl: ENSG00000017260
Vega: OTTHUMG00000136802
Pharos: P98194(Tbio)
UniProt: P98194
Position
3q22.1
AA seq 919 aa
MKVARFQKIPNGENETMIPVLTSKKASELPVSEVASILQADLQNGLNKCEVSHRRAFHGW
NEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQ
EYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD
LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSE
FGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVS
LAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEM
TVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNT
LMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMK
GAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLG
LVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEID
AMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVA
MGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLA
TLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKIL
VSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCS
NRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVER
SREKIQKHVSSTSSSFLEV
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgaaggttgcacgttttcaaaaaatacctaatggtgaaaatgagacaatgattcctgta
ttgacatcaaaaaaagcaagtgaattaccagtcagtgaagttgcaagcattctccaagct
gatcttcagaatggtctaaacaaatgtgaagttagtcataggcgagcctttcatggctgg
aatgagtttgatattagtgaagatgagccactgtggaagaagtatatttctcagtttaaa
aatccccttattatgctgcttctggcttctgcagtcatcagtgttttaatgcatcagttt
gatgatgccgtcagtatcactgtggcaatacttatcgttgttacagttgcctttgttcag
gaatatcgttcagaaaaatctcttgaagaattgagtaaacttgtgccaccagaatgccat
tgtgtgcgtgaaggaaaattggagcatacacttgcccgagacttggttccaggtgataca
gtttgcctttctgttggggatagagttcctgctgacttacgcttgtttgaggctgtggat
ctttccattgatgagtccagcttgacaggtgagacaacgccttgttctaaggtgacagct
cctcagccagctgcaactaatggagatcttgcatcgagaagtaacattgcctttatggga
acactggtcagatgtggcaaagcaaagggtgttgtcattggaacaggagaaaattctgaa
tttggggaggtttttaaaatgatgcaagcagaagaggcaccaaaaacccctctgcagaag
agcatggacctcttaggaaaacaactttccttttactcctttggtataataggaatcatc
atgttggttggctggttactgggaaaagatatcctggaaatgtttactattagtgtaagt
ttggctgtagcagcaattcctgaaggtctccccattgtggtcacagtgacgctagctctt
ggtgttatgagaatggtgaagaaaagggccattgtgaaaaagctgcctattgttgaaact
ctgggctgctgtaatgtgatttgttcagataaaactggaacactgacgaagaatgaaatg
actgttactcacatatttacttcagatggtctgcatgctgaggttactggagttggctat
aatcaatttggggaagtgattgttgatggtgatgttgttcatggattctataacccagct
gttagcagaattgttgaggcgggctgtgtgtgcaatgatgctgtaattagaaacaatact
ctaatggggaagccaacagaaggggccttaattgctcttgcaatgaagatgggtcttgat
ggacttcaacaagactacatcagaaaagctgaatacccttttagctctgagcaaaagtgg
atggctgttaagtgtgtacaccgaacacagcaggacagaccagagatttgttttatgaaa
ggtgcttacgaacaagtaattaagtactgtactacataccagagcaaagggcagaccttg
acacttactcagcagcagagagatgtgtaccaacaagagaaggcacgcatgggctcagcg
ggactcagagttcttgctttggcttctggtcctgaactgggacagctgacatttcttggc
ttggtgggaatcattgatccacctagaactggtgtgaaagaagctgttacaacactcatt
gcctcaggagtatcaataaaaatgattactggagattcacaggagactgcagttgcaatc
gccagtcgtctgggattgtattccaaaacttcccagtcagtctcaggagaagaaatagat
gcaatggatgttcagcagctttcacaaatagtaccaaaggttgcagtattttacagagct
agcccaaggcacaagatgaaaattattaagtcgctacagaagaacggttcagttgtagcc
atgacaggagatggagtaaatgatgcagttgctctgaaggctgcagacattggagttgcg
atgggccagactggtacagatgtttgcaaagaggcagcagacatgatcctagtggatgat
gattttcaaaccataatgtctgcaatcgaagagggtaaagggatttataataacattaaa
aatttcgttagattccagctgagcacgagtatagcagcattaactttaatctcattggct
acattaatgaactttcctaatcctctcaatgccatgcagattttgtggatcaatattatt
atggatggacccccagctcagagccttggagtagaaccagtggataaagatgtcattcgt
aaacctcctcgcaactggaaagacagcattttgactaaaaacttgatacttaaaatactt
gtttcatcaataatcattgtttgtgggactttgtttgtcttctggcgtgagctacgagac
aatgtgattacacctcgagacacaacaatgaccttcacatgctttgtgttttttgacatg
ttcaatgcactaagttccagatcccagaccaagtctgtgtttgagattggactctgcagt
aatagaatgttttgctatgcagttcttggatccatcatgggacaattactagttatttac
tttcctccgcttcagaaggtttttcagactgagagcctaagcatactggatctgttgttt
cttttgggtctcacctcatcagtgtgcatagtggcagaaattataaagaaggttgaaagg
agcagggaaaagatccagaagcatgttagttcgacatcatcatcttttcttgaagtatga

DBGET integrated database retrieval system