KEGG   Homo sapiens (human): 27034
Entry
27034             CDS       T01001                                 

Gene name
ACAD8, ACAD-8, ARC42, IBDH
Definition
(RefSeq) acyl-CoA dehydrogenase family member 8
  KO
K11538  isobutyryl-CoA dehydrogenase [EC:1.3.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00852  Valine degradation
N00853  ALDH6A1 deficiency in valine degradation
N00854  HIBCH deficiency in valine degradation
N00855  ACAD8 deficiency in valine degradation
Disease
H01279  Isobutyryl-CoA dehydrogenase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    27034 (ACAD8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     27034 (ACAD8)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 27034
NCBI-ProteinID: NP_055199
OMIM: 604773
HGNC: 87
Ensembl: ENSG00000151498
Vega: OTTHUMG00000167177
Pharos: Q9UKU7(Tbio)
UniProt: Q9UKU7
Structure
PDB: 
1RX0

Position
11q25
AA seq 415 aa
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREM
APNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTT
AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQG
DHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNS
QPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLN
VRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATD
ECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgctgtggagcggctgccggcgtttcggggcgcgcctcggctgcctgcccggcggtctc
cgggtcctcgtccagaccggccaccggagcttgacctcctgcatcgacccttccatggga
cttaatgaagagcagaaagaatttcaaaaagtggcctttgactttgctgcccgagagatg
gctccaaatatggcagagtgggaccagaaggagctgttcccagtggatgtgatgcggaag
gcagcccagctaggcttcggaggggtctacatacaaacagatgtgggcgggtctgggctg
tcacgtcttgatacctctgtcatttttgaagccttggctacaggctgcaccagcaccaca
gcctatataagcatccacaacatgtgtgcctggatgattgatagcttcggaaatgaggaa
cagaggcacaaattttgcccaccgctctgtaccatggagaagtttgcttcctactgcctc
actgaaccaggaagtgggagtgatgctgcctctcttctgacctccgctaagaaacaggga
gatcattacatcctcaatggctccaaggccttcatcagtggtgctggtgagtcagacatc
tatgtggtcatgtgccgaacaggaggaccaggccccaagggcatctcatgcatagttgtt
gagaaggggacccctggcctcagctttggcaagaaggagaaaaaggtggggtggaactcc
cagccaacacgagctgtgatcttcgaagactgtgctgtccctgtggccaacagaattggg
agcgaggggcagggcttcctcattgccgtgagaggactgaacggagggaggatcaatatt
gcttcctgctccctgggggctgcccacgcctctgtcatcctcacccgagaccacctcaat
gtccggaagcagtttggagagcctctggccagtaaccagtacttgcaattcacactggct
gatatggcaacaaggctggtggccgcgcggctgatggtccgcaatgcagcagtggctctg
caggaggagaggaaggatgcagtggccttgtgctccatggccaagctctttgctacagat
gaatgctttgccatctgcaaccaggccttgcagatgcacgggggctacggctacctgaag
gattacgctgttcagcagtacgtgcgggactccagggtccaccagattctagaaggtagc
aatgaagtgatgaggatactgatctctagaagcctgcttcaggagtag

DBGET integrated database retrieval system