KEGG   Homo sapiens (human): 27034Help
Entry
27034             CDS       T01001                                 

Gene name
ACAD8, ACAD-8, ARC42
Definition
(RefSeq) acyl-CoA dehydrogenase family member 8
  KO
K11538  isobutyryl-CoA dehydrogenase [EC:1.3.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
Disease
H01279  Isobutyryl-CoA dehydrogenase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    27034 (ACAD8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     27034 (ACAD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 27034
NCBI-ProteinID: NP_055199
OMIM: 604773
HGNC: 87
Ensembl: ENSG00000151498
Vega: OTTHUMG00000167177
Pharos: Q9UKU7(Tbio)
UniProt: Q9UKU7
Structure
PDB: 

Position
11q25
AA seq 415 aa AA seqDB search
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREM
APNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTT
AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQG
DHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNS
QPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLN
VRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATD
ECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggagcggctgccggcgtttcggggcgcgcctcggctgcctgcccggcggtctc
cgggtcctcgtccagaccggccaccggagcttgacctcctgcatcgacccttccatggga
cttaatgaagagcagaaagaatttcaaaaagtggcctttgactttgctgcccgagagatg
gctccaaatatggcagagtgggaccagaaggagctgttcccagtggatgtgatgcggaag
gcagcccagctaggcttcggaggggtctacatacaaacagatgtgggcgggtctgggctg
tcacgtcttgatacctctgtcatttttgaagccttggctacaggctgcaccagcaccaca
gcctatataagcatccacaacatgtgtgcctggatgattgatagcttcggaaatgaggaa
cagaggcacaaattttgcccaccgctctgtaccatggagaagtttgcttcctactgcctc
actgaaccaggaagtgggagtgatgctgcctctcttctgacctccgctaagaaacaggga
gatcattacatcctcaatggctccaaggccttcatcagtggtgctggtgagtcagacatc
tatgtggtcatgtgccgaacaggaggaccaggccccaagggcatctcatgcatagttgtt
gagaaggggacccctggcctcagctttggcaagaaggagaaaaaggtggggtggaactcc
cagccaacacgagctgtgatcttcgaagactgtgctgtccctgtggccaacagaattggg
agcgaggggcagggcttcctcattgccgtgagaggactgaacggagggaggatcaatatt
gcttcctgctccctgggggctgcccacgcctctgtcatcctcacccgagaccacctcaat
gtccggaagcagtttggagagcctctggccagtaaccagtacttgcaattcacactggct
gatatggcaacaaggctggtggccgcgcggctgatggtccgcaatgcagcagtggctctg
caggaggagaggaaggatgcagtggccttgtgctccatggccaagctctttgctacagat
gaatgctttgccatctgcaaccaggccttgcagatgcacgggggctacggctacctgaag
gattacgctgttcagcagtacgtgcgggactccagggtccaccagattctagaaggtagc
aatgaagtgatgaggatactgatctctagaagcctgcttcaggagtag

DBGET integrated database retrieval system