KEGG   Homo sapiens (human): 27035Help
Entry
27035             CDS       T01001                                 

Gene name
NOX1, GP91-2, MOX1, NOH-1, NOH1
Definition
(RefSeq) NADPH oxidase 1
  KO
K08008  NADPH oxidase 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    27035 (NOX1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    27035 (NOX1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    27035 (NOX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27035 (NOX1)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    27035 (NOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 NAD_binding_1 FAD_binding_6 TraX
Motif
Other DBs
NCBI-GeneID: 27035
NCBI-ProteinID: NP_008983
OMIM: 300225
HGNC: 7889
Ensembl: ENSG00000007952
Vega: OTTHUMG00000022007
Pharos: Q9Y5S8(Tchem)
UniProt: Q9Y5S8
Position
Xq22.1
AA seq 564 aa AA seqDB search
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgggtggttaaccactggttttcagttttgtttctggttgtttggttaggg
ctgaatgttttcctgtttgtggatgccttcctgaaatatgagaaggccgacaaatactac
tacacaagaaaaatccttgggtcaacattggcctgtgcccgagcgtctgctctctgcttg
aattttaacagcacgctgatcctgcttcctgtgtgtcgcaatctgctgtccttcctgagg
ggcacctgctcattttgcagccgcacactgagaaagcaattggatcacaacctcaccttc
cacaagctggtggcctatatgatctgcctacatacagctattcacatcattgcacacctg
tttaactttgactgctatagcagaagccgacaggccacagatggctcccttgcctccatt
ctctccagcctatctcatgatgagaaaaaggggggttcttggctaaatcccatccagtcc
cgaaacacgacagtggagtatgtgacattcaccagcattgctggtctcactggagtgatc
atgacaatagccttgattctcatggtaacttcagctactgagttcatccggaggagttat
tttgaagtcttctggtatactcaccacctttttatcttctatatccttggcttagggatt
cacggcattggtggaattgtccggggtcaaacagaggagagcatgaatgagagtcatcct
cgcaagtgtgcagagtcttttgagatgtgggatgatcgtgactcccactgtaggcgccct
aagtttgaagggcatccccctgagtcttggaagtggatccttgcaccggtcattctttat
atctgtgaaaggatcctccggttttaccgctcccagcagaaggttgtgattaccaaggtt
gttatgcacccatccaaagttttggaattgcagatgaacaagcgtggcttcagcatggaa
gtggggcagtatatctttgttaattgcccctcaatctctctcctggaatggcatcctttt
actttgacctctgctccagaggaagatttcttctccattcatatccgagcagcaggggac
tggacagaaaatctcataagggctttcgaacaacaatattcaccaattcccaggattgaa
gtggatggtccctttggcacagccagtgaggatgttttccagtatgaagtggctgtgctg
gttggagcaggaattggggtcaccccctttgcttctatcttgaaatccatctggtacaaa
ttccagtgtgcagaccacaacctcaaaacaaaaaagatctatttctactggatctgcagg
gagacaggtgccttttcctggttcaacaacctgttgacttccctggaacaggagatggag
gaattaggcaaagtgggttttctaaactaccgtctcttcctcaccggatgggacagcaat
attgttggtcatgcagcattaaactttgacaaggccactgacatcgtgacaggtctgaaa
cagaaaacctcctttgggagaccaatgtgggacaatgagttttctacaatagctacctcc
caccccaagtctgtagtgggagttttcttatgtggccctcggactttggcaaagagcctg
cgcaaatgctgtcaccgatattccagtctggatcctagaaaggttcaattctacttcaac
aaagaaaatttttga

DBGET integrated database retrieval system