KEGG   Homo sapiens (human): 27039Help
Entry
27039             CDS       T01001                                 

Gene name
PKD2L2, TRPP5
Definition
(RefSeq) polycystin 2 like 2, transient receptor potential cation channel
  KO
K04991  polycystin 2L2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   27039 (PKD2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans DUF4834
Motif
Other DBs
NCBI-GeneID: 27039
NCBI-ProteinID: NP_001287850
OMIM: 604669
HGNC: 9012
Ensembl: ENSG00000078795
Vega: OTTHUMG00000163306
Pharos: Q9NZM6(Tdark)
UniProt: Q9NZM6
Position
5q31.2
AA seq 624 aa AA seqDB search
MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV
MSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIY
YENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYST
SNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNA
NVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQE
VKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYF
LACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFA
YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFF
VLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTK
GSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYA
VELEKELHYINLKLNQVVRKVSAL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcgtcacggtggcaccgaggcggggcttcgaaacataagttgcattacaga
aaggaagtagaaattacaaccacacttcaggaattgttactctactttatttttttaata
aacctatgtatattgacttttgggatggtaaacccacatatgtattacttaaacaaggtt
atgtcatctctatttttggacacttctgtgcctggtgaagaaagaaccaactttaagtcc
attcgcagcataactgatttttggaagtttatggaaggaccccttttggaaggtctgtac
tgggattcatggtacaataaccagcagctgtataatttaaagaacagcagtcgcatctac
tatgaaaatatacttctaggagttcccagagttcgtcaactaaaagtccgcaacaacaca
tgcaaagtctattcatcttttcagtctttgatgagtgaatgttatggcaaatatacttct
gcaaatgaagacctctctaattttggccttcaaattaatactgaatggagatattctact
tctaataccaactccccttggcactggggatttcttggtgtttaccgaaatgggggatac
attttcactttatcaaaatcgaaatctgaaaccaaaaacaagttcattgaccttcgactg
aacagctggatcacaagagggactagagttatttttattgatttttccttatataatgct
aatgtaaatctattttgtattatcagattggtggcagaattccctgcaactggaggaata
cttacttcatggcagttttactctgtgaagctcctcagatatgttagctactatgactat
tttattgcttcctgtgaaatcacattctgtatttttctttttgtcttcacaacacaagaa
gtcaaaaaaataaaagaatttaagtctgcctatttcaaaagtatttggaactggctagaa
ttgctacttttgctgttgtgttttgtggctgtttccttcaacacatactataatgtacaa
atttttctcttacttggacagctgttgaaaagtactgaaaaatattcagatttctatttt
cttgcatgctggcacatttattacaataatataattgctattaccatcttttttgcatgg
ataaagatattcaaattcataagctttaacaagacaatgtctcagctgtcatcaaccttg
tcccgttgtgttaaagacatagtaggatttgccatcatgttttttataatattctttgct
tatgcccagttaggatttcttgtttttggatcacaagttgatgacttttccacttttcag
aattccatatttgcacaatttcgaattgttcttggagattttaattttgctggtattcag
caagccaatcctatcttgggacccatttacttcatcactttcatcttttttgtgttcttt
gtcctgctgaatatgttcttggcaattattaatgatacctattctgaagtgaaagctgac
tattcaataggcagaaggctagattttgaacttggcaaaatgattaaacagagttacaaa
aatgttctcgagaaattcagactgaagaaagctcaaaaagatgaagacaagaaaaccaaa
ggcagcggagatttggctgaacaagccagaagagaaggctttgacgaaaatgagattcaa
aacgcagagcagatgaaaaaatggaaagagaggcttgagaaaaagtattattctatggaa
attcaagatgactaccagcctgtcactcaagaagaatttcgagaactttttttatatgct
gtggagctggagaaggaattacactacatcaatttgaagctaaatcaagtggtgagaaag
gtttcagctctatag

DBGET integrated database retrieval system