KEGG   Homo sapiens (human): 27040Help
Entry
27040             CDS       T01001                                 

Gene name
LAT, IMD52, LAT1, pp36
Definition
(RefSeq) linker for activation of T cells
  KO
K07362  linker for activation of T cells
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05135  Yersinia infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    27040 (LAT)
   04015 Rap1 signaling pathway
    27040 (LAT)
   04064 NF-kappa B signaling pathway
    27040 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    27040 (LAT)
   04660 T cell receptor signaling pathway
    27040 (LAT)
   04658 Th1 and Th2 cell differentiation
    27040 (LAT)
   04659 Th17 cell differentiation
    27040 (LAT)
   04664 Fc epsilon RI signaling pathway
    27040 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    27040 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    27040 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    27040 (LAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAT LAX
Motif
Other DBs
NCBI-GeneID: 27040
NCBI-ProteinID: NP_055202
OMIM: 602354
HGNC: 18874
Ensembl: ENSG00000213658
Vega: OTTHUMG00000131761
Pharos: O43561(Tbio)
UniProt: O43561 A0A024QZD6
Position
16p11.2
AA seq 262 aa AA seqDB search
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPW
PPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRG
AQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAP
ALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALS
SQEAEEVEEEGAPDYENLQELN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggccatcctggtcccctgcgtgctggggctcctgctgctgcccatcctggcc
atgttgatggcactgtgtgtgcactgccacagactgccaggctcctacgacagcacatcc
tcagatagtttgtatccaaggggcatccagttcaaacggcctcacacggttgccccctgg
ccacctgcctacccacctgtcacctcctacccacccctgagccagccagacctgctcccc
atcccaagatccccgcagccccttgggggctcccaccggacgccatcttcccggcgggat
tctgatggtgccaacagtgtggcgagctacgagaacgagggtgcgtctgggatccgaggt
gcccaggctgggtggggagtctggggtccgtcctggactaggctgacccctgtgtcgtta
cccccagaaccagcctgtgaggatgcggatgaggatgaggacgactatcacaacccaggc
tacctggtggtgcttcctgacagcaccccggccactagcactgctgccccatcagctcct
gcactcagcacccctggcatccgagacagtgccttctccatggagtccattgatgattac
gtgaacgttccggagagcggggagagcgcagaagcgtctctggatggcagccgggagtat
gtgaatgtgtcccaggaactgcatcctggagcggctaagactgagcctgccgccctgagt
tcccaggaggcagaggaagtggaggaagagggggctccagattacgagaatctgcaggag
ctgaactga

DBGET integrated database retrieval system