KEGG   Homo sapiens (human): 27044Help
Entry
27044             CDS       T01001                                 

Gene name
SND1, TDRD11, Tudor-SN, p100
Definition
(RefSeq) staphylococcal nuclease and tudor domain containing 1
  KO
K15979  staphylococcal nuclease domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00225  EBV EBNA2 binding to host-cell-protein
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    27044 (SND1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    27044 (SND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNase TUDOR
Motif
Other DBs
NCBI-GeneID: 27044
NCBI-ProteinID: NP_055205
OMIM: 602181
HGNC: 30646
Ensembl: ENSG00000197157
Vega: OTTHUMG00000157560
Pharos: Q7KZF4(Tbio)
UniProt: Q7KZF4 A0A140VK49
Structure
PDB: 

Position
7q32.1
AA seq 910 aa AA seqDB search
MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctccgcgcagagcggcggctcctccgggggacccgcggtccccaccgtgcag
cggggcatcatcaagatggtcctctcagggtgcgccatcattgtccgaggtcagcctcgt
ggtgggcctcctcctgagcggcagatcaacctcagcaacattcgtgctggaaatcttgct
cgccgggcagccgccacacaacctgatgcaaaggatacccctgatgagccctgggcattt
ccagctcgagagttccttcgaaagaagctgattgggaaggaagtctgtttcacgatagaa
aacaagactccccaggggcgagagtatggcatgatctaccttggaaaagataccaatggg
gaaaacattgcagaatcactggttgcagagggcttagccacccggagagaaggcatgaga
gctaataatcctgagcagaaccggctttcagaatgtgaagaacaagcaaaggcagccaag
aaagggatgtggagtgaggggaacggttcacatactatccgggatctcaagtataccatt
gaaaacccaaggcactttgtggactcacaccaccagaagcctgttaatgctatcatcgag
catgtgcgggacggcagtgtggtcagggccctgctcctcccagattactacctggttaca
gtcatgctgtcaggcatcaagtgcccaacttttcgacgggaagcagatggcagtgaaact
ccagagccttttgctgcagaagccaaatttttcactgagtcgcgactgcttcagagagat
gttcagatcattctggagagctgccacaaccagaacattctgggtaccatccttcatcca
aatggcaacatcacagagctcctcctgaaggaaggtttcgcacgctgtgtggactggtcg
attgcagtttacacccggggcgcagaaaagctgagggcggcagagaggtttgccaaagag
cgcaggctgagaatatggagagactatgtggctcccacagctaatttggaccaaaaggac
aagcagtttgttgccaaggtgatgcaggttctgaatgctgatgccattgttgtgaagctg
aactcaggcgattacaagacgattcacctgtccagcatccgaccaccgaggctggagggg
gagaacacccaggataagaacaagaaactgcgtcccctgtatgacattccttacatgttt
gaggcccgggaatttcttcgaaaaaagcttattgggaagaaggtcaatgtgacggtggac
tacattagaccagccagcccagccacagagacagtgcctgccttttcagagcgtacctgt
gccactgtcaccattggaggaataaacattgctgaggctcttgtcagcaaaggtctagcc
acagtgatcagataccggcaggatgatgaccagagatcatcacactacgatgaactgctt
gctgcagaggccagagctattaagaatggcaaaggattgcatagcaagaaggaagtgcct
atccaccgtgttgcagatatatctggggatacccaaaaagcaaagcagttcctgcctttt
cttcagcgggcaggtcgttctgaagctgtggtggaatacgtcttcagtggttctcgtctc
aaactctatttgccaaaggaaacttgccttatcaccttcttgcttgcaggcattgaatgc
cccagaggagcccgaaacctcccaggcttggtgcaggaaggagagcccttcagcgaggaa
gctacacttttcaccaaggaactggtgctgcagcgagaggtggaggtggaggtggagagc
atggacaaggccggcaactttatcggctggctgcacatcgacggtgccaacctgtccgtc
ctgctggtggagcacgcgctctccaaggtccacttcaccgccgaacgcagctcctactac
aagtccctgctgtctgccgaggaggccgcaaagcagaagaaagagaaggtctgggcccac
tatgaggagcagcccgtggaggaggtgatgccagtgctggaggagaaggagcgatctgct
agctacaagcccgtgtttgtgactgagatcactgatgacctgcacttctacgtgcaggat
gtggagaccggcacccagttggagaagctgatggagaacatgcgcaatgacattgccagt
cacccccctgtagagggctcctatgccccccgcaggggagagttctgcattgccaaattt
gtagatggagaatggtaccgtgcccgagtagagaaagtcgagtctcctgccaaaatacat
gtcttctacattgactacggcaacagagaggtcctgccatccacccgcctgggtacccta
tcacctgccttcagcactcgggtgctgccagctcaagccacggagtatgccttcgccttc
atccaggtgccccaagatgatgatgcccgcacggacgccgtggacagcgtagttcgggat
atccagaacactcagtgcctgctcaacgtggaacacctgagtgccggctgcccccatgtc
accctgcagtttgcagattccaagggcgatgtggggctgggcttggtgaaggaagggctg
gtcatggtggaggtgcgcaaggagaaacagttccagaaagtgatcacagaatacctgaat
gcccaagagtcagccaagagcgccaggctgaacctgtggcgctatggagactttcgagct
gatgatgcagacgaatttggctacagccgctaa

DBGET integrated database retrieval system